KEGG   Schizosaccharomyces pombe (fission yeast): SPCC613.09
Entry
SPCC613.09        CDS       T00076                                 

Gene name
sen54
Definition
(RefSeq) putative tRNA-splicing endonuclease subunit Sen54
  KO
K15326  tRNA-splicing endonuclease subunit Sen54
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPCC613.09 (sen54)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing endonuclease complex
    SPCC613.09 (sen54)
SSDB
Motif
Pfam: tRNA_int_end_N2 tRNA_int_endo_N
Other DBs
NCBI-GeneID: 2538979
NCBI-ProteinID: NP_587697
PomBase: SPCC613.09
UniProt: O74908
Position
III:join(94731..94831,94909..95046,95116..96031)
AA seq 384 aa
MDAQDEDNPFTNLETTVDVTEEIQDWRFLSNVEKDQGTYTIPKRGQKDFEPDGTNKQHSA
LDLSRKAMFDALSVERLISAKHAIIATWNAQNGMSCVEKAHGPLFKTMGTADSQNRMWLL
PEETLYLVERGSMECWSEEGLPMSLQAVYSASIPLCGSLENYLVYAHLRRCGFSVIRSNL
VPVKEDEYRCDSKIMNFKDLLFLGLGKASQILQTFNFRKLAFPFSKRRRQSILLHDTFYT
YEEVYHDLQIVRGYVPIACNLITSSDSLFQITFHAYKPSASFKKSALSEPDFRICVVSSQ
DTLLPTIFEIDALFSSTPLRQNMPQHMFQRLKEGYRNIIIAIVDYGVISYIRLSDVCFEE
KVYTDFSKKGSKRKRVSKKFQQLV
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggatgcacaggatgaagataatccatttacgaatcttgaaactactgtagacgtcaca
gaagaaattcaagattggagatttttatcaaatgtcgaaaaagaccaagggacatacact
atcccaaaacgtggacaaaaagactttgaaccagatggcaccaataagcaacattctgct
ctcgacttgagcaggaaggcgatgtttgatgccctttcagtggagagattaatatcggcc
aaacatgcaataatagctacttggaatgcccaaaatgggatgtcttgtgttgaaaaggca
catggacctttgtttaaaaccatgggtactgctgactctcaaaatcgcatgtggttactt
ccagaggagactttgtatcttgttgaacgtggatcgatggaatgctggtcagaagaagga
ttgccaatgagtttgcaagcagtttactcagcctctattcctttatgtggtagcttagaa
aattatcttgtttatgctcatttacggagatgtggtttttcggttatacgttcaaaccta
gttccagtaaaagaagatgaatatcgatgcgattcgaaaattatgaatttcaaggattta
ttgtttttaggattgggaaaggcttcacaaatattacaaacatttaactttcggaaacta
gcttttccattttcaaagcggaggaggcagtctatcctcttacatgatacattttataca
tacgaagaagtgtatcatgatttgcaaattgtccgcggttatgttccaatcgcttgtaat
cttataacatcttcagattcattatttcaaatcacatttcacgcatacaaaccttcagct
tcattcaaaaaatcggccttatcagagcctgattttaggatatgtgtggttagctctcag
gatacattattacctactatttttgagattgatgcgcttttttcaagtactcctcttcga
caaaacatgccacagcatatgtttcaaagactaaaggaagggtacagaaacattattatt
gcaattgtagattatggagttataagctacattcggctatcggatgtttgttttgaagaa
aaagtttatacagacttctctaaaaagggatctaaaaggaaaagggtgagtaaaaaattt
caacaattggtctaa

DBGET integrated database retrieval system