KEGG   Schizosaccharomyces pombe (fission yeast): SPCC622.08cHelp
Entry
SPCC622.08c       CDS       T00076                                 

Gene name
hta1
Definition
(RefSeq) histone H2A alpha
  KO
K11251  histone H2A
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC622.08c (hta1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPCC622.08c (hta1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    SPCC622.08c (hta1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPCC622.08c (hta1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 2539499
NCBI-ProteinID: NP_588180
PomBase: SPCC622.08c
UniProt: P04909
Position
III:complement(1411524..1411922)
Genome map
AA seq 132 aa AA seqDB search
MSGGKSGGKAAVAKSAQSRSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYL
AAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPK
TSGRTGKPSQEL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaggtaaatctggtggtaaggctgctgttgccaaatctgctcaatcccgttct
gccaaggccggtttggctttccccgttggtcgtgtccatcgtttgttacgtaagggtaac
tatgctcaacgtgttggtgctggtgctcccgtttacttggccgccgttttggaatatttg
gctgctgaaattctcgaattggctggaaacgctgctcgtgacaacaagaagactcgtatc
attccccgtcatcttcaactcgccatccgtaacgatgaagagttgaacaaacttcttggt
cacgttaccattgctcaaggtggtgttgttcccaacatcaacgcccatcttttgcccaaa
acttctggtcgcactggaaagcctagtcaggagctgtaa

DBGET integrated database retrieval system