KEGG   Schizosaccharomyces pombe (fission yeast): SPCC622.09Help
Entry
SPCC622.09        CDS       T00076                                 

Gene name
htb1
Definition
(RefSeq) histone H2B Htb1
  KO
K11252  histone H2B
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    SPCC622.09 (htb1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPCC622.09 (htb1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF3915 CENP-W Xpo1
Motif
Other DBs
NCBI-GeneID: 2539523
NCBI-ProteinID: NP_588181
PomBase: SPCC622.09
UniProt: P04913
Position
III:1412484..1412864
Genome map
AA seq 126 aa AA seqDB search
MSAAEKKPASKAPAGKAPRDTMKSADKKRGKNRKETYSSYIYKVLKQVHPDTGISNQAMR
ILNSFVNDIFERIATEASKLAAYNKKSTISSREIQTAVRLILPGELAKHAVTEGTKSVTK
YSSSAQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctgaaaagaaacccgcttccaaggctcccgccggtaaggctcctagggat
accatgaagtctgctgataagaagcgtggtaaaaacagaaaggaaacttattcatcctat
atttacaaggtgttgaagcaagttcaccctgatactggtatttccaaccaagccatgcgt
atcttgaactctttcgtcaacgatatttttgagcgtattgccactgaggcttccaagctt
gctgcttacaacaagaagtccactatttcttcccgtgaaatccagactgctgttcgtttg
attcttcccggtgagttagccaagcacgccgttaccgaaggtaccaaatccgtcaccaag
tattcttcttctgctcagtaa

DBGET integrated database retrieval system