KEGG   Schizosaccharomyces pombe (fission yeast): SPCC622.10c
Entry
SPCC622.10c       CDS       T00076                                 

Definition
(RefSeq) putative exocyst complex subunit Sec5
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Sec5
Other DBs
NCBI-GeneID: 2539341
NCBI-ProteinID: NP_588182
PomBase: SPCC622.10c
UniProt: O94598
Position
III:complement(join(1413637..1415911,1415978..1416150))
AA seq 815 aa
MSADEEILAHYGLTSLSQDYWTEKPDFAIANASVDVQSPTTGVHHERNRSEDILRTGGAT
SETTKDASAAGPVTPSFAMKRSQTSVQPSMSSQIAIGGMRNPMATRKIAGTYRDAPDNSM
QQTSTGVHRSSSWLTTDGTHQLLSLMETNFNKFIAAKETIDNVYAQIISTLSHAGPAKTM
DMCEESISGALQQLQLFNTESTNEVDISYGELLVMRECEALFTYPEKFRLYHKQEKYSLL
MQEIENAKKLYEKDRERLAKVNPKLVYLVDHAWEIIQATIDGICASIWNQILQSQGDFAF
VVRTLCDLLKLKPNPISGRDPVLYATVSQQKYLYNLMKERFSYFEKIIKSRQEDFSKLSC
TRASPMLVWRAVARGCNLDYTLRGRPEVFAGMQLIEWANACVLKIVREIKEVELYAKEFI
SGIQQASYPEAAKHYGRDPKQMGVVVEKLNSQCLEMVYSFVGERGERLEMDGAFVLIQLH
YFQRVADLLPKRIRTVFSMAATRCIVDTWMLQHAPQSKSANIEEMFIVDANENQVLEPEL
MVVDVLRELNKLYIPPHREEIVREIHHAFYKVLYANARFPSMSVSMANWESDVWSLASST
LIDFVQHRNQHDMKKLASKMTTSLPVFSTSITRSDVLHFVTRLLNLRSRLVPYQKFLLQT
FPLNEVSPSLDPRISKSLRNLQDLYKLLAIRDTSFSNTTPSSISKLSIQPPTFQLFSTLE
TIYLELKDSMPPNEAADWMIATTSCMLAQFALHSPYAFFHDIPSISHFLNKCLPPTILDL
LQQIQRKAEASSISPTTETATKTRLKFQFIEMIFS
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgagtgcagacgaagagatccttgctcattatggtttgacaagtttaagtcaagactac
tggactgagaagccggactttgcgattgccaatgcctcagtagatgtacaaagtcctact
accggtgttcatcatgaacgtaatcgttcagaagacatacttcgtacgggtggcgctaca
tccgaaactaccaaagatgctagtgcagctggaccagtaacaccatcatttgcaatgaaa
cgtagtcaaacgagcgtccaaccatctatgtcatctcaaatagctattggaggtatgaga
aacccgatggctacacgtaaaatcgctgggacatatcgcgatgctcctgataactctatg
caacagacgagtacgggagttcatcgatcatcttcgtggttaaccaccgatggaactcat
cagttattatcgttgatggaaacaaactttaataaatttattgccgcgaaggaaactata
gataatgtttatgctcaaattatcagcaccttgagtcatgctggacccgctaagacaatg
gatatgtgcgaagaatcaatctcaggcgcacttcagcaacttcagcttttcaacacagaa
tcaactaatgaggtcgatatttcttacggtgaactattggtcatgcgggagtgtgaggct
ctattcacataccctgagaaatttcgcttatatcacaaacaagaaaaatatagtttatta
atgcaggagattgaaaatgctaaaaaattatatgaaaaagatcgcgaacgtttagcaaag
gtcaatccaaagctcgtgtatttagttgatcatgcttgggaaattattcaagccactata
gatggcatttgcgcctctatctggaatcaaattttacaaagtcaaggagattttgctttt
gttgtccgtacattatgcgatttgcttaaattaaaacccaatcccattagcggacgggac
cctgtactatatgctacagtcagtcaacaaaaatatttgtacaatcttatgaaggaaaga
ttttcctattttgaaaaaataattaagtctagacaagaagacttttctaaattatcgtgc
acgcgtgcatcgcccatgctggtttggcgtgctgtggctcgtggatgcaatttggattat
acacttaggggacgacctgaagtttttgcaggaatgcagcttatcgaatgggcgaatgca
tgtgttttaaaaattgttcgtgaaatcaaggaagttgaactgtatgccaaagaattcatt
agtggcattcaacaagctagctatccagaagccgccaagcattatgggcgtgacccgaag
caaatgggtgtagtggttgagaagttgaattctcagtgtttggaaatggtttattctttt
gtgggtgaacgtggtgagcgtttagaaatggatggagcctttgttcttattcaattacat
tacttccaaagagttgctgatttgcttcccaaacgcataagaacagtattttctatggcc
gctacccgttgtattgttgatacatggatgctccaacatgcgcctcaatccaaatcagct
aatatagaagagatgttcattgtagatgccaatgaaaaccaggtattggaaccggaatta
atggttgtggatgtattacgagaattgaataagctgtacataccacctcatcgtgaagag
attgttcgagagattcatcatgcgttttataaggttttgtatgcgaatgcaaggttcccc
agtatgagcgtttcgatggcgaactgggagtccgatgtatggtctcttgcttcttctacc
ctaattgatttcgtgcagcaccgtaaccagcatgatatgaaaaagcttgcttctaaaatg
acaacctctctacctgttttctctacctccattacccgctctgatgttttacacttcgta
actcgactgttaaacttgcgttcacgtttggtaccttaccaaaagtttctcttacagaca
tttcctcttaacgaggtttctccctccctcgatccgagaatttcaaaatctcttcgaaac
ttgcaagatctttataaattgttggccatacgggataccagtttttccaataccacaccc
tcttccatatccaagttgagcattcaaccaccgaccttccaattgttttccactctagaa
accatatacttagaattaaaagactccatgcctcctaatgaagcggcagattggatgata
gccacaacgtcttgtatgctcgctcagtttgctttacactcaccatatgcctttttccac
gacattcctagtatttcgcatttcttaaataaatgccttccacctaccatactcgacttg
ctacaacaaatccaaagaaaggcagaagccagctccataagtccgactacggaaacagct
acgaaaacacgactcaagtttcagtttattgaaatgatcttttcataa

DBGET integrated database retrieval system