KEGG   Schizosaccharomyces pombe (fission yeast): SPCC63.02cHelp
Entry
SPCC63.02c        CDS       T00076                                 

Gene name
aah3
Definition
(RefSeq) GPI-anchored glycosyl hydrolase family 13 protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPCC63.02c (aah3)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SPCC63.02c (aah3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1966
Motif
Other DBs
NCBI-GeneID: 2539415
NCBI-ProteinID: NP_587976
PomBase: SPCC63.02c
UniProt: Q9Y7S9
Position
III:complement(833966..835660)
Genome map
AA seq 564 aa AA seqDB search
MFGVYFVLLFLSSALIHVANAGSNAEWRKRIIYQILTDRFAVDDGSTDNPCDPDANQYCG
GTWKGIENKLDYIEDMGFNAIWISPIDKNIEGDIDGAGYAYHGYWNTDYESLNEHFGTED
DLVSLITAAHKAGIWVMLDSIVNSMALAPPLADADYSSLNPFNKESYFHPYCLIDWDITD
NETNVMDCWQDSGVLLADLDVESSDVSSYLSDHFKSLISKYDFDGLRIDAVKMMNYTFFP
DFVDATGVYSVGEVFSYDPDTMCSYMSVLPGVTNYFLQLYINFSFTATGAGFTLIPTYQE
VMASNCSKYDSTLMLTFIENHDLYRFPYYTSDQSQIMGALSFVLIWDGIPSIFYGQEQGF
NGGEDPANRPALWLTDYDQSNPYYTVIKTMVAFRKFVITQDPDWVTSTYQSIESAVDHYV
GQKNDVLVMFNNMGVTNNLTIYEVETNYTANEVVSDVFGHRTLTVGADKTLTASMTNGYP
LIMYPHSKMSGFTLPTVNRTVMPSTSATATTTVYTSYYSPSYSARSFTGTGSIFTISSSS
RLILSFKTLVFGLGVTAMLFVLFF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtgtttattttgttctcctatttctttcaagcgccctcattcatgttgctaat
gctggtagtaatgctgagtggcgcaaacgtattatttatcaaattttgacggatcgtttc
gcggttgatgatggaagcacggataatccatgtgatccggatgcaaaccagtattgtggt
ggtacctggaagggtatcgagaacaaactggattacatcgaggatatgggtttcaatgcg
atttggatatctcccattgataaaaatattgaaggagatatcgacggtgctggttatgct
tatcacggctattggaacactgattatgagtccctcaatgaacactttggtacagaagat
gatttagttagccttattactgctgctcataaagcgggtatctgggtaatgttggatagt
atcgtcaattctatggcacttgctcctccgctagcagatgctgactattcatctcttaat
ccttttaacaaggagagctacttccatccgtactgtcttattgattgggatatcacagat
aatgagacgaacgtaatggattgttggcaagattctggtgtattgttggccgatttggat
gtcgaaagttcagacgtttcttcctatttgagtgatcatttcaaaagtcttatttctaaa
tacgattttgatggactgcgtattgatgctgtgaaaatgatgaactacacattctttcct
gatttcgttgatgctacgggtgtttacagcgttggtgaagttttctcttatgatcctgat
actatgtgtagttacatgagtgtccttcctggagttaccaattactttttgcagttgtac
ataaacttctcttttactgctactggtgctggattcactcttattcccacttaccaggag
gtaatggcttcaaactgttcaaaatatgatagtactttaatgttgacttttatcgaaaat
cacgatttgtacagatttccttattacacaagtgaccagtcacagattatgggggctttg
tcatttgtgttgatttgggacggcataccctcaattttctacggacaagaacagggattc
aatggtggtgaggatcctgctaatcgtcctgcactttggcttactgattacgatcaatca
aacccgtactataccgttattaaaacgatggttgcatttagaaagtttgtcattactcag
gatccggattgggtcacttccacatatcaatcgatcgaatctgctgttgatcactatgtt
ggacaaaaaaatgatgttctcgtcatgttcaataatatgggagttaccaacaaccttaca
atttatgaagttgagacgaattacactgccaatgaagtagtctctgatgtcttcggtcac
agaactttaaccgttggtgccgataaaaccttgactgccagtatgaccaacggatatccc
ttgattatgtatccacattcgaagatgtctggttttacattaccaactgtcaatcgtaca
gtcatgccatctacatcggcaactgccacaaccactgtctatacctcttattactctcct
tcttattctgccagatcatttactggtactggtagtatatttacgatctcttcatcatct
agacttatcctttctttcaagactttagtttttggcttgggtgttaccgcaatgctcttt
gttttattcttctag

DBGET integrated database retrieval system