KEGG   Schizosaccharomyces pombe (fission yeast): SPCC63.04
Entry
SPCC63.04         CDS       T00076                                 
Symbol
mok14
Name
(RefSeq) alpha-1,4-glucan synthase Mok14
  KO
K00749  alpha-1,3-glucan synthase [EC:2.4.1.183]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spo01003]
    SPCC63.04 (mok14)
Enzymes [BR:spo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.183  alpha-1,3-glucan synthase
     SPCC63.04 (mok14)
Glycosyltransferases [BR:spo01003]
 Polysaccharide
  Structural polysaccharide
   SPCC63.04 (mok14)
SSDB
Motif
Pfam: Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Cas_Csm6
Other DBs
NCBI-GeneID: 2539506
NCBI-ProteinID: NP_587978
PomBase: SPCC63.04
UniProt: Q9Y704
Position
III:839962..844071
AA seq 1369 aa
MNIKKKSFLFQFLFGWIVLSSAQWLSVLDEAENLNSSFSLESVDSFAPVRPRFIIDEDFA
EDYNLTVDILHRPLQENFDSFFPNVEAYVESGNSNGDLMSDNGKLDDLNSRAAYSALKAL
QNSYGSSHLYRFTPYELFGQSIWIEEAPEVNHVGWSIMFDNLGRYFLLELRGLREVTFAL
FITFSIVPIITGILTVYIYKKKYCVIKFNKSGRSKKKDSWLKRSKDELLRTDSANLLTLN
DNDEPVMIRHSCKRTCILFATLEYNIPEWNIKIKIGGLGVMAELMSKTLKQYDLVWVVPC
VGDITYPVAETAPSLVVKVVNQDYEVKVFYHYKDNIKYVLLDSPIFRKRTSHDPYPPRMD
DISSAIFYSVWNQSIAAIIRREKVDIYHINDYHGALAPIYNLPEVIPCAISLHNAEFQGL
WPLQSSIDEREVCGLFNVSKTICREYIQFGNAFNLMHCGVSYVRRHQSGYGVVGVSNKYG
QRSWVRYPVFWSLKKIGQLPNPDPTDIGLSVNPVNQQLPDFAEYASVRKENKRKAQEWAG
LTIDDEADLLVFVGRWSVQKGIDILADLAPTLLEKFNIQLIVVGPLIDLYGKFAAEKFMY
IMERYPGRVFSKPEFVHLPPFIFEGADFALIPSRDEPFGLVAVEFGRRGAICIGSRVGGL
GEMPGWWYSVESSSTAYLLKQLEKSCTLALKSTPEMRHKLRIAALQQRFPVDEWVALYDR
LIRNCIKAHNKQQQRRSIKSFFSCITPNKPTKDVNDILSEKSAFSPADYEHSIDIREHTS
YDANSMDNDSDEDNYEQAESIISSLSSSALSELSYISESSMNIGSRLDERFIDANGVAIR
DFSAELTYLTPENSKGKLSIDHFLNKVQSRWHDEEHHYYKTGFRKRVYKYLKIKDKKSKD
VDPDDDLVNQLPLNAYTKPRYKSAASTRLNIYQRILYLKVFTWPLYTIFLSLGQILSISS
FQLSLLSGFEDNNQISLYVITGVFILSTIVWWGLYRNLPSVHSLSLPFAVYALAFLFTGI
SSMSLPYHIRGWLSYAATWVYAIAAASGPLYFTLNFEDEHCSGLGSSITRACVLQGVQQL
WLSFLWLWGTLSSRLDYNYKVLLQPINSVYVVAGVWPVSFVLLSVCILLYKGLPPFYRQK
PGSIPAFSKSLLHRKVVICFLISVINQNFWMSTLISQAWRFFWGSKLTKLWKIVVMTVSF
LVGAWLIIFYVLRKLSNKHTWMVPVLGLGFGAIKWMHVFWGTSNVGIFLPWAGIAGPYLS
RALWLWLGILDSIQGIGNGLILLQTLSRRHVTNTLMISQLAGSATSILARFVSPTKTGPA
NVFPDLTGYTPVDRAKPVANAPFWICLILNVALCIMYLRCYHRENISRP
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgaatataaagaaaaagagctttctctttcaatttttgttcggatggattgtactgtct
tcggctcaatggctatcggttttggatgaggcagagaatttgaactcttctttttcatta
gaaagtgttgattcttttgctccagtaagaccaaggtttataatcgatgaagactttgct
gaagattacaaccttactgttgatatcttgcatcgtccacttcaggaaaatttcgattct
ttctttccaaacgttgaagcgtatgttgaaagtggaaattctaatggtgatttgatgagc
gacaatggtaaactagatgatttaaattctcgagcggcctattctgcccttaaagccctt
caaaactcttatggatcatcccatctttatcgctttacaccctatgaattgtttgggcaa
tctatttggattgaagaagcacctgaagtgaatcatgtcggttggtctattatgttcgat
aaccttggccgttactttttactagagttgcgcggtctacgcgaggttacttttgctttg
tttattactttttcaatcgttcctattattacaggaatccttactgtttacatttacaag
aagaaatactgtgtcataaaattcaataagtccggtcgttctaagaagaaggatagctgg
ttgaaaaggtctaaggatgaattacttcgtacggatagcgcaaatcttctgactttgaat
gataatgatgagcctgtaatgattagacattcatgtaaaaggacgtgcattcttttcgca
acactcgaatataacattccggaatggaatataaaaattaaaattggaggtttaggagtg
atggctgaattaatgagtaagacattaaagcagtatgatttggtttgggtcgttccttgt
gtgggagatatcacatatccagtggctgaaactgctccatctttggtagttaaagtggtt
aaccaagactatgaagtgaaagttttctatcattataaagacaacatcaaatatgttctt
ctcgactctcccatattcagaaagcggacatcacacgatccttatcctcctcgtatggat
gatatatcttcagccattttttacagtgtttggaatcagtccattgctgctataatacgt
cgtgaaaaggttgatatctatcatattaatgattatcatggtgcacttgctccaatttat
aatcttccagaggtcatcccttgtgcaatttcactccataatgccgaattccaaggtttg
tggcctttacagtccagtattgatgaaagagaggtttgtggtttattcaatgtttccaaa
accatttgcagagaatacattcaattcggtaatgctttcaacctgatgcattgcggtgtt
tcttatgttcgtcgtcatcagtccggttacggagtagttggtgtttctaacaaatatggc
caacgctcatgggttcgatatccagttttttggagtctcaaaaaaattggacaattgcct
aaccctgatcctaccgacatcggtttgagtgttaatcctgtgaatcaacaacttcctgac
tttgcagaatatgcttcggtaaggaaggaaaacaagagaaaggcacaagaatgggccggt
ttgacaatcgatgatgaagcggatcttctggtatttgtaggtagatggtcagtgcaaaaa
ggtattgatattttagctgatctcgcgccaaccctcttagaaaagttcaacattcaatta
attgttgttgggcctctaattgatttatatggtaaatttgcggcagaaaagttcatgtac
ataatggaacgttatccagggcgcgttttctcaaaacccgagttcgttcatctaccaccc
ttcatttttgaaggagctgactttgccctaattccttctcgtgatgaaccttttggttta
gtcgcggtagaatttggcaggagaggtgctatttgtatcggctcaagagtcggaggttta
ggagaaatgccaggatggtggtattctgttgaatctagctcaaccgcctatttactgaaa
caacttgagaagtcttgtactctggctctaaaatcaactcctgaaatgcgccataaactg
agaatcgccgcccttcagcaacgctttcctgtagatgagtgggtggcattgtatgacaga
cttatacgaaactgtattaaggctcataacaaacagcagcaaagaagaagcataaaatca
tttttcagttgcattacaccgaacaagcctactaaagatgttaacgatattttatccgaa
aaaagtgcattttctcctgcagattatgagcactctatagatattagagaacatacatca
tatgatgccaattcaatggataatgattctgatgaagataattatgaacaagcagaatca
attatttcatcactaagtagttcagcactttccgaattatcttacatatctgagagttcc
atgaatataggttctaggcttgatgaacgctttatcgatgcaaatggcgttgcaataagg
gatttttctgctgagttaacttatttgactcctgaaaactcaaaaggaaaattatctatc
gatcatttcttgaacaaagtccaatcacgttggcatgacgaagaacatcactattacaag
acaggatttaggaagcgtgtttacaaatatttaaagatcaaagacaaaaagtctaaagat
gtggaccctgatgatgacttggtaaaccaacttcctttaaatgcttacacgaaaccccga
tataagagtgcggctagtactcgactaaacatttatcaaagaattctatatcttaaagtt
ttcacttggccgctttacacaatcttcctctcgttaggccaaattttatctatttcatcg
tttcaactttctcttttatcaggatttgaagataataatcaaatatctttgtacgtaatc
acaggcgtttttattctttcaacgattgtttggtggggtttgtatcggaaccttccaagt
gttcattccttatcgcttccttttgcagtgtatgctttggctttcctgtttactggcatt
tcatctatgtcactaccttaccatattcgtggatggctaagttacgctgcgacatgggtt
tatgcaatagctgctgcgagtgggccattgtatttcactctgaattttgaagatgaacat
tgttcggggttgggatcttcgatcacacgtgcttgtgttttacaaggagttcaacaactt
tggttatcgtttctttggctctggggaaccttatccagtcgtttggactataactataaa
gtgctactacaacccattaatagtgtttatgttgtagcaggagtttggccggtatcattc
gttcttctatcagtatgtattcttttatataaggggttgccacctttctatcgacaaaaa
cccggatcgatccctgcattttctaaatctttattacaccgaaaggtggtaatatgtttc
ctgatttcagtcatcaatcaaaatttttggatgtctacattaattagccaagcttggaga
tttttctggggttccaaacttaccaaattatggaagattgttgtaatgactgtatccttt
ttagttggtgcgtggttaataattttttatgtgcttcgaaaactttcgaataagcacact
tggatggttcctgtactaggattagggtttggtgctattaaatggatgcatgtcttctgg
ggaacttcaaacgttggaattttcttaccgtgggcgggcattgcaggaccatatcttagt
cgtgccttgtggctttggttgggaatactcgattccattcaaggcattggcaatggccta
attttacttcaaaccttgtcaagaagacacgtaactaacacattaatgataagccaactt
gccggttctgccacctcaatacttgcacgctttgtgtcgccaacaaagactggaccagct
aatgtttttccagatttgactggatacactccagtagaccgtgcaaagccagtggctaat
gctccgttttggatttgcctgatcttgaatgtagctctatgtatcatgtatcttcggtgc
tatcatagagaaaacattagcagaccgtga

DBGET integrated database retrieval system