KEGG   Schizosaccharomyces pombe (fission yeast): SPCC645.02
Entry
SPCC645.02        CDS       T00076                                 
Symbol
gep4
Name
(RefSeq) putative cardiolipin synthase PGP phosphatase domain-containing Gep4
  KO
K01094  phosphatidylglycerophosphatase GEP4 [EC:3.1.3.27]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00564  Glycerophospholipid metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPCC645.02 (gep4)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.27  phosphatidylglycerophosphatase
     SPCC645.02 (gep4)
SSDB
Motif
Pfam: PGP_phosphatase Hydrolase_like
Other DBs
NCBI-GeneID: 2539038
NCBI-ProteinID: NP_588111
PomBase: SPCC645.02
Ensembl: SPCC645.02
UniProt: Q9Y7U3
Position
III:1229431..1230662
AA seq 209 aa
MLINIEGIQAFCQTIRNPRRIIPHATFPTFSQIPCNINYFLEQKFQVPVDIRALVLDKDN
CITLPNETTIAEAELKKIREFQNIYGEKNVILLSNSIGTRKLDPTGELAAHFQQKWNIPV
VRHSKLKPLCTEELYTYLSNNSHVSSASQILFIGDRLLTDITLANIMGSWGVWLTRGVGN
TTNMMMEVESWLYKRIHTQNPYIPTNRKS
NT seq 630 nt   +upstreamnt  +downstreamnt
atgttgattaatatcgagggaattcaagcattttgtcagacaattcgaaatcctcgtcga
ataatcccacatgctacatttcctacattctcccaaattccttgtaacataaactacttt
ttggaacaaaaatttcaagtaccagttgatattcgtgccttggttctcgacaaagataat
tgtatcactttgccaaatgagactacaattgctgaagcagaattgaaaaagattagggag
ttccaaaatatttatggagaaaaaaacgttatcttgctcagcaattccattggaactagg
aaacttgatccaactggagaactggcagctcattttcagcagaaatggaatatcccagtt
gtacgacattctaaacttaagcctctgtgcactgaagaattgtatacctatttatcaaat
aattctcatgtcagtagcgcctctcaaatactctttattggagatcgcctgttaactgat
attacacttgcaaacataatgggttcctggggtgtatggctgacaagaggtgtcgggaat
acaacaaatatgatgatggaagtcgaatcgtggctttataaacgtatacatacgcaaaat
ccgtatatcccaactaacaggaaaagctga

DBGET integrated database retrieval system