KEGG   Schizosaccharomyces pombe (fission yeast): SPCC645.13
Entry
SPCC645.13        CDS       T00076                                 

Name
(RefSeq) putative transcription elongation regulator
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: TFIIS_M SPOC PHD zf-CW
Other DBs
NCBI-GeneID: 2538700
NCBI-ProteinID: NP_001342882
PomBase: SPCC645.13
Position
III:1258634..1260799
AA seq 721 aa
MVRKSTRRTAKASEKPPETVVRCVCKSQEDIGDTWVQCDGCDCWQHASCVGLADKDIPES
YYCEVCHSRSDVSSQVQNSPNKDEEHQTADLLASNEGNEKNNEENNVVSSDSKEAITKES
GAELESSEPASTNSNVGMTTRSGRQSPRTPIGSTTPKSSHSPPSTRKRRGSVGTTATHTK
RSKNAPKTSPKDASNETADQEKELSLHTSIDEIQNPVRKSVAKAWVSVFEKIIEKAKLEG
VQGLEDLNSTSLALQLEHIMFMVLSYTTDHSLTPNNKYREKFRALRFNLVDDKNPAFRAR
VLKNEISFNDLVNLSSEEMANPDLKNLAEEIRQQSTENTVIKQHLIAPRDRLLDEDKLTQ
QDELGIAENDDAMFPKPPGELVAPISIAEEEPTIDSKSPTLPEHNPLSEDDTSNGDKAAK
RKGSFNDTKPIVNVPSIVEIDDPTILDIVEEEPLARNDSFSSPYSPAEDMAEESEFFGMK
EKIWTGKVKMATVSEFHANALNLFGDVSASHLFEILSATALIEGRISVSSVLQYFHALRK
TPSKEIIAVLFVPTEQNSQGFDILYDYFVKRNRYGVLHSKSNSVKDAYIIPMPSGNSVPE
LLDLLPKVDLPKDRNFQYFMGLFVLNKSSSRHESVERATPITTSTNGIPSTYQSASGTPT
NPVHSYPSLESIINALTPSDMLLIKDVVENNPQIRANPSLAINPQFMQNAISAAQKKASK
Q
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggtaagaaaaagcactagaaggacggcaaaagcctcagaaaaacctcctgaaactgtt
gttcggtgtgtttgtaaatcgcaagaagacattggcgatacgtgggttcaatgtgatggg
tgtgattgctggcaacatgccagttgcgttggattagcggataaggatatacctgaaagc
tactattgtgaagtttgtcattcgcgaagcgacgtttcatcacaagtacaaaattctccc
aataaggatgaagagcatcagacagctgatttacttgcctctaatgaagggaacgagaaa
aacaatgaagaaaataatgttgtatcttctgattcaaaagaggcgattactaaagagtca
ggcgctgaactagaatcatccgagcctgcttcgacaaattctaatgttggaatgactact
aggtctggtcgacaatctcctaggactcctattggctccacgacaccaaaaagttctcat
tctccaccttcaactcgaaaacgaagaggcagtgttggtacgacggctactcataccaaa
cgtagcaagaatgcaccaaaaacatctcctaaggatgcttccaatgaaactgcagatcag
gaaaaggagcttagtttacacacttctatcgatgaaattcaaaaccctgttagaaaaagt
gttgccaaagcctgggtttccgtttttgaaaaaatcattgagaaagcaaaacttgaaggt
gtgcaaggattagaagaccttaattctacatccttagcgcttcagcttgagcatattatg
tttatggtgctttcgtatacaactgatcattcgttaactccgaacaacaaatatcgagag
aagtttcgtgctttacgattcaacttggttgatgacaaaaacccggcatttcgagcgcgc
gtgttaaaaaatgaaattagttttaacgatctggtcaacttatccagtgaagaaatggct
aatcctgacttgaagaacctagctgaggaaattcgtcaacaaagtactgaaaacacagtc
ataaagcaacatttgattgctccacgagatcgtttacttgatgaagataaacttacacaa
caagatgaacttggtattgcggaaaacgatgatgcgatgtttcccaaacctcctggagag
cttgtagctccaatttcaattgcagaagaagagcccacaattgattccaaaagtcctact
ttaccggaacataatcctctttctgaagacgatacatctaatggtgataaagctgcaaaa
agaaaagggagttttaacgacacaaaaccgatagtcaatgtcccttccatcgtggaaata
gatgatcctactatacttgacattgtagaagaggagcctcttgcgaggaacgattcattt
tcttctccgtattcgcctgctgaagatatggctgaggagtctgagttttttggcatgaaa
gagaaaatatggactggaaaagtaaaaatggctactgtttcagagtttcacgcaaatgcc
ttaaatttatttggtgatgttagtgctagtcatttatttgaaattttatctgcgacagct
ttaattgagggtcgtataagtgtatcatcagttttgcagtattttcatgctctaagaaaa
actccttctaaagaaataattgcggtgctattcgtacccactgagcaaaactcacaagga
tttgatattttgtacgattattttgtgaaaagaaatcgctatggagtgttacattcgaag
tctaattctgtgaaagatgcatacattattcctatgccatcaggaaacagcgtgcctgaa
ttacttgaccttcttcccaaggttgatttacctaaagatcgaaattttcagtatttcatg
ggcttatttgttcttaataaaagctcctctcgtcatgaatcagtagaaagagccactcct
atcactacttccacaaatggtattccatctacatatcagtctgcttctggtacacctact
aatccagttcattcctacccgtctctcgaaagtattattaatgctttaactccttctgat
atgctcttaattaaagatgttgttgagaacaatccacaaataagggcaaatccgtcgcta
gcaattaaccctcaatttatgcagaatgccatttcggcggctcagaaaaaggcgtccaaa
caataa

DBGET integrated database retrieval system