KEGG   Schizosaccharomyces pombe (fission yeast): SPCC736.07c
Entry
SPCC736.07c       CDS       T00076                                 

Definition
(RefSeq) putative prefoldin-like protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF3835
Other DBs
NCBI-GeneID: 2538840
NCBI-ProteinID: NP_587778
PomBase: SPCC736.07c
UniProt: O74953
Position
III:complement(join(324921..326872,326947..327094))
AA seq 699 aa
MNDERLVAINFEQQIFSKISEISESVGRAIRYCKEDGKVEGCETASHVDFLNHIHLLLGN
YNNDLASSIEKKKSELIVRNSEGLPVMDIHEEVDKDGNIISASVAPQRISSVIDYADVFR
SLPGFKNIENGGNRDTSSRIEELSEEEINDSTKNINYKAPEMGSLPSNTEFTSTPTLGVS
EFPSKHGDHSDSKTYESPISNSQAASLSDSDMVQQIKNGSKTSLFKKGFLFKKNNAMQNR
TTSNIKSNASAIEKNKETILNALNNSTLNENGHQDTQNEVLRDIVLEHPTAKAQDTGESN
KDNNTSTSKHKKRPKRLSKFKQAKLETKKSGNKDHATSSEKLSLGNESIHSINETRSSSI
EEPDNADNKIVEEEPMLLPVPTTAQGQNVLEAVQYDGLDSLEDMEALIQEMEEEGELDDN
SESEEDEHGMTIGFSKELKAPPDPQYFTEKTGATTYVNGNDESLNVSDFPQIVEQEELSS
KNPRKVHFSDTLEIKHVSRSGKANIEVIPAPTEEYDNLFGPDDFQSRISAFRKARSKLRA
KENEEGNHSNATCTIKNDDLSNTLNNRAANTKLNPKEEDKSTVESELKAPPKEKSSETSK
EYLNEPSVVKDFVVERTPSDKISESKEAFDAKVEEISDQRAISQRYYELRKKMIDNTGEY
IKDEEEQAVIPLDENGNEKPKMSRFMTARLRGRVPIYEH
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgaacgacgaaagactagtagccatcaattttgaacagcaaatcttctctaagattagc
gaaatttctgaatcagtcggtagggcgatccgttactgtaaggaagatggaaaagttgaa
ggatgtgaaacagcatcccatgtggatttcttaaatcatattcatttacttttgggaaat
tacaataatgacttagcatcttcaattgaaaagaagaaatccgagttgatagtaagaaac
tcagaagggttacctgttatggatattcatgaagaagttgataaagatggaaatattata
agtgcttctgttgctccacaaagaatttcatctgtaatagattatgcggatgtctttcga
tcccttcctggtttcaaaaatattgaaaatggggggaaccgtgatacatcttcgagaatt
gaagagctatctgaagaagaaattaacgattctacgaaaaatattaactacaaagctcca
gaaatgggctcattaccttctaatactgaatttacttcaactccaacacttggtgtctca
gaatttcccagcaaacatggtgatcattcagacagtaaaacatatgagagtcctattagt
aatagtcaggctgcttcattgagtgattcagatatggttcaacaaattaaaaatggtagc
aagacttctttgtttaaaaagggttttcttttcaaaaaaaataatgcaatgcaaaacaga
actacttcaaatataaagtcaaacgcttctgctattgaaaaaaataaagaaacgatattg
aatgctctcaataactctactttaaatgaaaatggacatcaagatacccaaaatgaagtt
ttacgagacattgtgttagagcatccgacagcgaaggcccaagatactggggaatctaat
aaagataataacactagcacgtctaaacataaaaaacgacctaagcgtctttcaaaattt
aaacaagctaagctagaaacaaaaaaatctggcaacaaagatcatgctacatctagtgaa
aagctttcactaggaaatgaatctattcattctataaacgaaactagaagtagtagtata
gaagaaccagataatgccgacaataaaattgtcgaagaagaaccgatgttactaccagtt
ccgacgactgcgcaaggacaaaatgttttggaagcagtacaatacgacggtttagactct
ttagaagatatggaggctctcattcaggaaatggaggaggaaggcgaattagatgataat
tctgagtctgaggaagatgaacatggtatgacgataggattttccaaggaactgaaagct
ccaccggatcctcaatattttacagaaaagactggtgctacaacttatgtcaatggtaat
gacgagagcctaaatgtcagtgactttccacaaatcgttgaacaagaagagctttcgtca
aaaaatcctcgaaaggtacatttttcagacacgctggaaattaaacacgtcagtcggagt
ggaaaggcgaatattgaagttatacctgctccaactgaagaatacgataatctttttgga
ccagacgattttcagagtcgtatttcagcgtttcgtaaagcaaggagcaaattgcgcgca
aaggaaaacgaagagggcaaccattctaatgccacatgtacaatcaagaacgatgatttg
agtaacacattaaataatcgggctgcgaatacaaagttaaatccaaaagaagaagacaaa
tctactgtagaatccgagcttaaagcaccgcctaaagaaaaaagctcggaaacttccaag
gaatatttaaatgaaccatctgtagtaaaagattttgtagttgaacgaactccatctgac
aaaattagcgagtctaaagaagcattcgatgcgaaagtcgaggaaattagtgatcaacga
gctatatcacaacgttactacgaactgagaaaaaaaatgatagataatacaggtgaatat
attaaggatgaagaagaacaggcagttatacctttggatgagaatggaaatgaaaaacct
aaaatgagccgatttatgaccgcgaggttgcgtggtcgtgttcccatttatgagcattag

DBGET integrated database retrieval system