KEGG   Schizosaccharomyces pombe (fission yeast): SPCC736.08
Entry
SPCC736.08        CDS       T00076                                 

Gene name
cbf11
Definition
(RefSeq) CBF1/Su(H)/LAG-1 family transcription factor Cbf11
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: LAG1-DNAbind BTD DUF3403
Other DBs
NCBI-GeneID: 2539560
NCBI-ProteinID: NP_587779
PomBase: SPCC736.08
UniProt: O74954
Position
III:join(327542..327623,327702..329461)
AA seq 613 aa
MGDYFAWDFANISGSNTSGSLNLNQLNLDNINNGLHNQEDGAGGRNENSERVGSGSPGSV
SMQVLSLFSAVNSALATLEKSEEFPSVVKDEQSIFPAVAKASNSLDELAQNIIPAPSPPG
FNRKRKTFDEDSSVEMIRRAISDHLDLLNNCCIGIANLNEDSVHKISLTRSGKPSQLVTV
SCRHSSVIQKSYGSEKRYLCPPPMVYINGNYSSIFNQSFRTEISIMNDFGQCSQPISEEY
TGQGCMIFRSLHISSLVAAKSKNLRLSLDMFSNVNNQLLSHLVTSSISIVSKPSKKGSKL
KISNITLRSGSVVSLYNRINSQTVRTKYTSIEAGQFCLRGDRWVPLRINLLLPDENGKLK
VCDDVDNPEPIKYGSIVELVDEATGTTSDPLIIRRVEKDHIAEEDGYVNQMHRIVLESAY
PISNVRHLKIAEHSSLAYSNNISVRWFLGATSAQNRNASSEAILPIEWEAVGNLSSNEMT
RVGDSVCWTIVGISHFDCTMMLPFNQNPVPTVTDYPYIEEPPEYLESSRSLQFKIGGYSV
GLQIWLGVHGPLSYSFTAAADTSTMGTVTLGLSQISYDPSCAEQKYPLLFVIPGGIVIIG
KCEILLTSSAFGN
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgggggactattttgcctgggattttgcaaatatctctgggagtaatacttctggctcc
ttaaatttaaatcagttgaacttggacaacataaataatggtttgcataatcaggaggat
ggagctggaggaaggaatgaaaattctgaaagagttggaagcgggagtcctggaagtgtt
tccatgcaggttttgtctctcttcagtgctgtaaactcagctttggctactttggaaaaa
tcagaggaattcccttctgtagttaaggatgaacagtcaatttttcctgctgtagcaaag
gcgtctaattcgttggacgagctggcccaaaacataattcctgctccttctcctcctggg
tttaatagaaaaagaaaaacctttgatgaagacagttctgtagagatgatccgaagagcc
atatcagatcatttggatttactgaacaattgttgtattggcattgctaatttgaatgag
gacagtgtgcacaaaatttcacttacacgttcagggaaacctagtcagctggtaacagtt
tcgtgtcgacattcctctgtcatacaaaagtcttatgggtcagagaaacgttacctatgt
ccaccccctatggtttatattaatgggaattactcttctatattcaatcagtcttttcgc
actgagatatcaataatgaatgattttgggcaatgttcgcaacccatcagcgaagaatac
actggccaaggatgtatgatttttcggtcactgcatatatcgagtttggtcgctgcgaaa
tctaaaaacttacggctttctctggacatgttctcgaatgtaaataaccaattgttatct
catttggttacttcttctattagtattgtctccaaaccttcgaaaaaaggaagcaaacta
aaaattagtaatattacgttgcgatccggttcagtcgtcagcctttataaccggattaat
tcacaaactgtacgtacaaagtatacatcgattgaggctggtcagttttgtcttcgcggt
gatagatgggtgccattgcgtattaacctgctattaccagatgaaaatggtaaactgaag
gtatgcgacgatgtcgataacccagaacccattaaatatggctccatcgttgaattggtc
gatgaagcaacaggaacgacgagtgaccctttaattattcgacgagtagaaaaagaccac
attgctgaggaggacggttacgttaatcaaatgcatagaattgtattagaaagcgcatat
cccatatcaaacgtacggcatcttaagatcgctgagcatagttcactggcatattccaat
aatatttcagtccgttggtttcttggggccacgtcggcacaaaacagaaatgcatctagt
gaggctatattgcccatagaatgggaagctgttggaaacttgagttcaaatgaaatgact
cgagttggagattctgtatgctggactatagtgggcatatcacattttgactgtacgatg
atgttaccattcaatcaaaatcctgtaccaacggttactgattatccatatattgaagag
ccacccgaatatttggagagctcgcgctcattacaatttaaaattggaggctattcggtc
ggattacaaatttggctaggtgttcatggaccattgtcgtatagttttaccgcagctgct
gatacgagtacaatgggtacggtcactctaggtctgtcgcaaatttcatatgatccttct
tgtgcagaacaaaagtatcctttgttgttcgtgattccaggtgggattgtcattattgga
aaatgcgagattttgctaacgtcaagtgcttttggaaactga

DBGET integrated database retrieval system