KEGG   Schizosaccharomyces pombe (fission yeast): SPCC736.11Help
Entry
SPCC736.11        CDS       T00076                                 

Gene name
ago1
Definition
(RefSeq) argonaute
  KO
K11593  eukaryotic translation initiation factor 2C
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPCC736.11 (ago1)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC736.11 (ago1)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SPCC736.11 (ago1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    SPCC736.11 (ago1)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     SPCC736.11 (ago1)
   microRNA pathway
    RISC loading complex
     SPCC736.11 (ago1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Piwi ArgoMid PAZ ArgoL1 ArgoN ArgoL2 FBD
Motif
Other DBs
NCBI-GeneID: 2539403
NCBI-ProteinID: NP_587782
PomBase: SPCC736.11
UniProt: O74957
Position
III:join(334137..334265,334637..337012)
Genome map
AA seq 834 aa AA seqDB search
MSYKPSSEIALRPGYGGLGKQITLKANFFQIISLPNETINQYHVIVGDGSRVPRKQSQLI
WNSKEVKQYFGSSWMNSVYDGRSMCWSKGDIADGTIKVNIGSESHPREIEFSIQKSSKIN
LHTLSQFVNSKYSSDPQVLSSIMFLDLLLKKKPSETLFGFMHSFFTGENGVSLGGGVEAW
KGFYQSIRPNQGFMSVNVDISSSAFWRNDSLLQILMEYTDCSNVRDLTRFDLKRLSRKFR
FLKVTCQHRNNVGTDLANRVYSIEGFSSKSASDSFFVRRLNGEEQKISVAEYFLENHNVR
LQYPNLPCILVKNGAMLPIEFCFVVKGQRYTAKLNSDQTANMIRFAVQRPFERVQQIDDF
VHQMDWDTDPYLTQYGMKIQKKMLEVPARVLETPSIRYGGDCIERPVSGRWNLRGKRFLD
PPRAPIRSWAVMCFTSTRRLPMRGIENFLQTYVQTLTSLGINFVMKKPPVLYADIRGSVE
ELCITLYKKAEQVGNAPPDYLFFILDKNSPEPYGSIKRVCNTMLGVPSQCAISKHILQSK
PQYCANLGMKINVKVGGINCSLIPKSNPLGNVPTLILGGDVYHPGVGATGVSIASIVASV
DLNGCKYTAVSRSQPRHQEVIEGMKDIVVYLLQGFRAMTKQQPQRIIYFRDGTSEGQFLS
VINDELSQIKEACHSLSPKYNPKILVCTTQKRHHARFFIKNKSDGDRNGNPLPGTIIEKH
VTHPYQYDFYLISHPSLQGVSVPVHYTVLHDEIQMPPDQFQTLCYNLCYVYARATSAVSL
VPPVYYAHLVSNLARYQDVTADDTFVETSEASMDQEVKPLLALSSKLKTKMWYM
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtataaaccaagctcagaaatagctttacgtcccggttatggagggttgggcaag
cagattactttgaaagctaacttttttcaaatcatttctttacctaacgagactatcaac
cagtatcatgtcatagtaggtgatggttcacgtgtcccacgaaagcaatcccagttgatt
tggaattctaaagaagttaaacagtattttggatcttcctggatgaattctgtttatgat
gggcgaagcatgtgttggtctaaaggtgatattgctgatggcaccatcaaggtaaacata
ggcagtgagtcgcaccctcgagaaattgaattctctattcaaaaatcatctaaaattaat
ttgcatactcttagccagtttgtaaactcaaagtattcttcggatccgcaagttctaagc
agtataatgtttctggatttgctgttaaagaagaaaccatctgagactttgtttggcttc
atgcattctttttttacaggtgaaaacggagtttcacttggaggtggagtagaggcttgg
aaagggttttaccagtctatacgaccgaatcagggtttcatgtctgttaatgtagatata
tcttcgagtgcattttggcgtaatgattctttacttcagatccttatggaatacacagat
tgctcgaacgttagagacttaacacgttttgacctaaaacgtctttcccgcaagtttcgg
tttctaaaggtgacctgtcagcatcgcaataatgtcggtactgacctggcgaatagagtt
tattccatcgagggattttcctcaaaaagtgccagtgatagcttttttgttcgccgtctt
aatggtgaagagcaaaaaatctctgtagctgaatactttcttgaaaatcacaatgttcgt
ttgcaatatcctaacctaccttgcatattagtaaagaacggggcgatgcttcctattgaa
ttctgttttgttgtaaaaggtcagagatatactgcaaaactgaatagtgatcaaactgcc
aacatgatccgttttgcggtccaacgacctttcgaacgtgtccagcaaatcgatgatttt
gtccatcagatggattgggatacagatccctacctaacccaatatggtatgaaaattcag
aaaaagatgctcgaagttccagctcgtgttttagaaactccttctattcgttacggagga
gattgcattgagcgtcccgttagtggacgttggaatttacgtggtaaacggttccttgat
ccgccgagggctcctattagatcttgggctgtaatgtgttttacttcaacgcgtagactc
cctatgaggggtattgaaaatttcctgcaaacatatgtacaaacactcacttcgttggga
attaattttgttatgaaaaaacctccagttttgtatgcagatattagagggagtgttgaa
gaactatgtataacgttatataaaaaagctgaacaggttggtaatgctcctcctgactat
ctcttttttattttggataaaaattcgcctgaaccatatggttccattaaacgtgtttgc
aatactatgttaggggttccttctcaatgtgctattagcaaacatattttacaaagcaag
ccccaatactgtgcaaacttaggcatgaagattaatgtcaaggttggaggaattaattgc
tcgttgatacccaaatccaaccctttgggaaatgttcctactcttattcttggtggagat
gtttatcaccctggggttggtgcaacaggtgtttcgattgcttcaattgtggcatcggta
gacctaaatggctgcaagtatacggctgtttcacgttcccaacctcgtcatcaagaagtg
attgaaggaatgaaggatatcgtggtatatctattgcaagggtttagggcaatgactaaa
caacaaccacaacgtattatctatttccgtgacggtacctcggaaggacaatttttatca
gtaataaacgatgagctttctcagattaaagaagcgtgtcatagtctatcaccaaaatac
aatccaaagattctagtatgcacaacgcagaagagacatcacgctcgtttcttcattaag
aacaaatccgacggagatagaaatggaaatcccctccctggtacaattattgaaaagcat
gttactcacccctatcagtacgatttttaccttatatcccacccatctctgcaaggcgtt
tcggtcccagttcactacacggttttgcacgacgaaattcagatgccaccggaccaattc
caaacactgtgttataatctttgttatgtttatgcaagagcaacaagtgctgtttccttg
gttccacctgtttattatgcgcatttggttagtaacttagcccgttatcaagacgtgaca
gccgatgatacttttgttgagacatcagaagcatcaatggatcaagaagtaaagccgctt
ttagctctatcaagtaaattgaaaacaaagatgtggtatatgtaa

DBGET integrated database retrieval system