KEGG   Schizosaccharomyces pombe (fission yeast): SPCC737.09c
Entry
SPCC737.09c       CDS       T00076                                 

Gene name
hmt1
Definition
(RefSeq) ATP-binding cassette-type vacuolar membrane transporter Hmt1
  KO
K23329  ATP-binding cassette, subfamily B, vacuolar membrane transporter HMT1/ACLQ
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPCC737.09c (hmt1)
Transporters [BR:spo02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB6, 7 subgroups
    SPCC737.09c (hmt1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 AAA_21 AAA_15 Zeta_toxin RsgA_GTPase AAA_24 AAA SbcCD_C TsaE AAA_29 Comm AAA_16
Other DBs
NCBI-GeneID: 3361134
NCBI-ProteinID: NP_588371
PomBase: SPCC737.09c
UniProt: Q02592
Position
III:complement(join(1914928..1917222,1917345..1917542))
AA seq 830 aa
MVLRYNSPRLNILELVLLYVGFFSIGSLNLLQKRKATSDPYRRKNRFGKEPIGIISWWIL
GIALTYVVDISNLVIYALRVPNWWPCKTTVVCLILFLLFWIIVLISCADSKALPKNADSI
LKAYRLSVLYVWAIDIVFETIFIVYSPHPNETFQGIVLADHVARLVLCVFATAIYLTYRR
KRHTHDPLDFEERQLTEESNVNENAISQNPSTVQLGVSASTSNFGTLKSTSKKPSDKSWA
EYFRSFSTLLPYLWPTKDYRLQFQIFICIVLLFLGRAVNILAPRQLGVLTEKLTKHSEKI
PWSDVILFVIYRFLQGNMGVIGSLRSFLWVPVSQYAYRAISTKALRHVLNLSYDFHLNKR
AGEVLTALTKGSSLNTFAEQVVFQIGPVLLDLGVAMVYFFIKFDIYFTLIVLIMTLCYCY
VTVKITSWRTEARRKMVNSWRESYAVQNDAIMNFETVKNFDADDFENERYGHAVDIYLKQ
ERKVLFSLNFLNIVQGGIFTFSLAIACLLSAYRVTFGFNTVGDFVILLTYMIQLQQPLNF
FGTLYRSLQNSIIDTERLLEIFEEKPTVVEKPNAPDLKVTQGKVIFSHVSFAYDPRKPVL
SDINFVAQPGKVIALVGESGGGKSTIMRILLRFFDVNSGSITIDDQDIRNVTLSSLRSSI
GVVPQDSTLFNDTILYNIKYAKPSATNEEIYAAAKAAQIHDRILQFPDGYNSRVGERGLK
LSGGEKQRVAVARAILKDPSIILLDEATSALDTNTERQIQAALNRLASGRTAIVIAHRLS
TITNADLILCISNGRIVETGTHEELIKRDGGAYKKMWFQQAMGKTSAETH
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggttctacgttacaacagcccacgcctcaatattcttgagctggtccttctatatgtc
ggattttttagtattgggtccttgaacttactgcagaaaaggaaagctacttctgatcct
tatcgtaggaaaaatcgcttcggcaaagaacctataggaataatttcctggtggatattg
ggaattgcattaacctacgtcgttgatatcagcaatcttgtcatctacgcattgcgagtt
ccaaattggtggccctgtaaaaccactgttgtctgtttaattctcttccttttattttgg
ataattgtacttatctcatgcgcagattctaaagctcttccaaaaaatgcggattccata
ctaaaggcctaccgccttagcgtcttgtacgtttgggctatagacattgtatttgaaaca
attttcattgtctacagtcctcatccaaatgaaacatttcaaggaattgtattggcggac
catgtagcccgattggtcttatgtgttttcgctacagctatatatctaacttatagacga
aagagacatacgcacgatcccctggattttgaggagcgtcaattaacagaagagtcaaac
gttaatgagaatgctatctctcaaaatccctcgaccgttcagctcggtgtatcggcatca
acctcgaattttggtacactcaaatcaacatcgaaaaaacctagtgataaatcttgggca
gaatatttccgttctttctctactttacttccctatctctggccgacaaaagattaccga
cttcagtttcagattttcatttgcatagttttactctttttggggcgagctgttaacata
cttgctccccgacaactgggtgtgttaactgaaaagctcacaaaacatagtgagaaaatt
ccttggtctgatgttattctattcgttatctatcgttttttgcaaggaaatatgggagta
attggttctcttcgatctttcttatgggttcctgtctctcaatatgcttatagagcgata
tcaactaaggctttgagacatgttctaaacctgtcatacgattttcatttgaataaacgt
gctggtgaggttttgaccgccttaactaaaggaagttcgttgaatacgtttgcagaacaa
gttgtgtttcagattgggcctgttttgttggatttgggagtagccatggtatactttttt
attaagtttgacatttattttacgcttattgtgttaattatgacactttgttactgttac
gttacggtcaaaattacatcttggcgtaccgaggctagaagaaagatggttaatagctgg
cgcgagagttatgctgtgcaaaatgacgcgattatgaatttcgaaaccgttaaaaatttt
gatgcagatgactttgaaaatgaacgatacggtcatgctgtggatatttatcttaagcaa
gagcggaaggtactatttagccttaattttttaaatatcgttcaaggtggaatatttaca
ttcagcttggcaattgcttgtctattaagtgcttatagagtaacattcggctttaacact
gtcggtgattttgtcatacttttgacatacatgattcagctacagcagcctcttaatttt
ttcggaactttatatcgttcattgcaaaatagcatcatcgatacagaaagactacttgaa
atttttgaggagaaacctactgtggtggagaaaccaaatgccccagatcttaaagtcact
caaggtaaggtaatattctctcatgtttcatttgcatatgatccacgaaaacctgtttta
tcagatatcaattttgttgcacaaccaggaaaagttattgcgttagtgggagaatcaggt
ggtgggaaatctacaattatgagaattcttttacgattcttcgatgtcaactcgggatcc
ataaccattgatgatcaagacatacgaaatgttacgttgtctagtcttcgatcttcaata
ggtgtagttccccaagatagtaccctttttaatgatactattctttacaatattaaatat
gctaaaccttctgcgaccaatgaggagatttatgctgctgctaaggctgctcaaattcac
gatcgtatattacaattcccagatggttataattctcgtgtcggagaaagaggcttaaag
ttaagcggtggtgaaaaacaacgtgtagcagttgccagagctatcttaaaagatccttca
attatccttctcgatgaagctacttctgctctggacacaaatactgagcgacaaatccag
gcagccttgaatagacttgcatctggccgaactgctatagtaatcgctcacaggctctcc
accatcaccaatgcagacttaattctttgtatttcgaatggtagaatcgttgagactggc
acacacgaagagttaataaagcgtgacggcggagcttacaaaaaaatgtggtttcaacaa
gcaatgggaaaaacttctgctgaaactcattaa

DBGET integrated database retrieval system