KEGG   Schizosaccharomyces pombe (fission yeast): SPCC777.03c
Entry
SPCC777.03c       CDS       T00076                                 

Name
(RefSeq) putative cysteine desulfurase nifs family protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2
Other DBs
NCBI-GeneID: 2538693
NCBI-ProteinID: NP_588249
PomBase: SPCC777.03c
UniProt: O74542
Position
III:complement(1601512..1602702)
AA seq 396 aa
MTVSEGIARIQAFRKQVPLVEKNENITFFNLSFQPPMNSIVANTINEYVDWGLYNPNPKP
LWQQKAEETRELVAKYLNASSSDSIAFTRDTTEGLNLFQRSMHFQPGDNVVLLDGEHPNH
GFGWISLQEAGLEVRLIPSKDIYYADASTFEPYVDEKTKAIGISSVMFHSGQLNNVKDIC
NKFRPENIHVLVDMTQQVGLSSIDVQELNVSACAFACHKGLSCPTGLGVLYVAPDVLPQL
KNVPPIVGAGAIENLDANLLVNLNPIYFSTARRFEHLNKSLITTLCLNNYLSFLMDIGFE
NIEQYLRELGKSLVDELSKLGVTIIGSKDPKKRSTHSYVAKILNPEWDAFLKNEGVYASQ
YRDGIRLSLGLYNNAADISRLANTIKKGVLNKIPFN
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgactgtttcagaaggcatcgcaaggattcaagcttttcgtaagcaggtcccattagtc
gaaaaaaatgaaaacataacctttttcaacctttcatttcaaccacccatgaactctata
gttgccaatactataaatgaatacgttgattggggtttgtacaatcctaatccaaaacca
ctatggcaacagaaagcagaagaaactagagagttagttgcaaaatatttaaatgcgtct
agttctgactcaattgcattcactagggacactactgagggattgaacttgttccaacgc
tctatgcattttcaacctggcgataacgtggtattattagatggagagcaccctaatcat
ggctttggatggatttcccttcaagaagctggtttagaagttcgattaataccgtctaaa
gatatatattatgctgatgcctcaacgtttgaaccgtatgtagatgaaaagacaaaagca
attggcatatcatctgtcatgttccattcgggacagctaaataacgtgaaagacatttgc
aataaatttcggcctgaaaacattcatgtattagtcgacatgacccaacaggttgggtta
agcagcatagatgttcaggaattaaatgtttctgcatgcgcatttgcatgtcataaaggt
ttaagctgtccgactggtttgggagtattatatgttgctcccgatgtgcttccacaactt
aaaaatgtacctccaattgttggagctggagccattgaaaatcttgatgcaaatttacta
gtcaatctgaatcctatttatttttctacggctcgaagatttgaacatttgaacaagtcg
ctgattactactctgtgtttgaacaattaccttagcttcttaatggacatcggttttgaa
aatatagaacaatatcttcgtgaacttggaaagtcgctggttgatgagctatccaagctt
ggtgtaacaattatcggctcaaaggatccaaagaaaaggtctacccactcttacgttgcg
aaaatcttgaaccctgagtgggatgcatttctcaaaaacgaaggtgtgtacgcttctcaa
tatagagatgggattcgactttctttgggtctttacaacaatgctgccgatatttcgagg
ttagccaataccatcaagaaaggagttctcaataagataccctttaattaa

DBGET integrated database retrieval system