KEGG   Schizosaccharomyces pombe (fission yeast): SPCC777.09c
Entry
SPCC777.09c       CDS       T00076                                 
Symbol
arg1
Name
(RefSeq) acetylornithine aminotransferase
  KO
K00818  acetylornithine aminotransferase [EC:2.6.1.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00220  Arginine biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01210  2-Oxocarboxylic acid metabolism
spo01230  Biosynthesis of amino acids
Module
spo_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SPCC777.09c (arg1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPCC777.09c (arg1)
Enzymes [BR:spo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     SPCC777.09c (arg1)
Amino acid related enzymes [BR:spo01007]
 Aminotransferase (transaminase)
  Class III
   SPCC777.09c (arg1)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-GeneID: 2538726
NCBI-ProteinID: NP_588255
PomBase: SPCC777.09c
Ensembl: SPCC777.09c
UniProt: O74548
Position
III:complement(1613047..1615028)
AA seq 441 aa
MFQRRSLLSVRSSGSQIAFRRFVSLTHKDPTPDTTSCNIIKKEGANIISVYARYPVVAAK
GEGSYLFDKEGRKYIDFTSGVAVTSLGHAHPEVARLAADQCSKLVHSSNLFYNEPAIELS
NVINNSLAKNSGIAGPTKIFFANCGTEANETALKFARKAAFEKYGEGKSQIVYFNNSFHG
RSLGSLSITANPKYKRGFQPLLPDVVQAVYNDPASIEQFVNDKTAAVIVEPVQGEGGICP
AKPEFLIALRKACDKVGASLIYDEIQCGLGRSGDLWAHSIVKDVASPDIITVAKPLANGL
PIGATIVSSKIAAEIHPGEHGSTFGGNPVACRVGTFCVNELGSSKILQNVRKQHKALTSR
FDDFVAKYPNLIRGYAGRGLLLGLQFTEPPAKFIELARQQGLLLLPGGNNNTRVLPSLNV
KDEVIAKGLDIMESTLKALSK
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtttcaaagacgatcacttctctctgttcgttcgtctggttcccaaatcgcctttcgt
cgatttgtcagccttacccacaaagatccaactcctgatacaaccagttgcaatattatc
aagaaggaaggggcgaatattatatcagtttatgcacgctatccagtcgtagctgctaaa
ggtgagggctcctatttgtttgacaaggaaggtcgtaaatacattgacttcacctctggc
gtagctgttacatctttgggtcatgctcatcctgaagttgctagacttgccgctgatcaa
tgctccaaattagtccatagtagcaaccttttctacaacgagcctgccattgagctatct
aatgtcattaataattctttggcaaaaaatagcggtattgctggccccacaaaaattttc
tttgccaattgtggtactgaggccaatgagacagccttgaagttcgctcgtaaggcagcg
tttgagaagtatggagaagggaagagtcaaattgtttactttaataactctttccacggc
cgttctttgggatctcttagtatcactgcgaaccccaaatataaacgtggtttccaacca
ttacttcctgatgtcgtccaagccgtctataatgaccctgcatccatagagcaatttgtc
aatgacaaaactgcggctgttattgtcgagcccgttcaaggtgaaggtggtatttgtcct
gccaagcctgaatttttgattgctttgcgcaaggcctgtgataaggttggtgcttcttta
atctatgatgaaattcaatgcggacttggtcgcagcggtgatctttgggcccatagtatc
gttaaggatgtcgctagtcccgatattatcacagttgccaaacctttggctaatggtcta
cctatcggcgccaccattgtctccagtaagatcgctgctgaaattcaccctggtgaacat
ggcagtactttcggaggtaatcctgttgcttgccgtgtaggcacattctgtgttaatgaa
ttagggtcatccaagattctacaaaacgttagaaagcaacacaaggctcttacttcacgt
tttgatgactttgttgccaaataccctaatcttattcgtggatatgctggtcgtggtctt
cttcttggtttgcaatttaccgagccccctgctaaatttattgagcttgctcgtcaacaa
ggtcttttactcttaccaggtggaaacaacaacacccgtgtccttcctagtttgaatgtt
aaagatgaggttattgctaagggtttggatatcatggagagcactttgaaggctttaagt
aagtaa

DBGET integrated database retrieval system