KEGG   Schizosaccharomyces pombe (fission yeast): SPCC825.02
Entry
SPCC825.02        CDS       T00076                                 

Name
(RefSeq) putative glucosidase II Gtb1
  KO
K08288  protein kinase C substrate 80K-H
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPCC825.02
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:spo04091]
    SPCC825.02
Lectins [BR:spo04091]
 P-type lectins
  SPCC825.02
SSDB
Motif
Pfam: PRKCSH-like PRKCSH_1 FTA4 FapA
Other DBs
NCBI-GeneID: 2538725
NCBI-ProteinID: NP_588052
PomBase: SPCC825.02
UniProt: Q9USH8
Structure
Position
III:join(1025552..1025651,1025701..1025784,1025841..1025879,1025918..1026574,1026702..1026839,1026892..1027111,1027156..1027438)
AA seq 506 aa
MKFSQWYTLTAPLLISSLYTVNAANDLRGVASDKSDLYKPDAKGNWKCLGSDKLISFNQV
NDDYCDCPDGSDEPGTSACHNGKFFCKNTGYISSYIPSNRVDDTVCDCCDGSDESLIKCP
NTCAQKAREYLATLEEHNRLVKNGLKIREQWALESAKKTDEVKARYKEISDSLVAVSAEK
TQLSEKVEKMKRSTDLGAEAVLPLDFQDLRVALLSLVDERNEMQERLDILTNLLDELTLL
YETDKFDETMKEAILSFEDLKEQEIRRKVSSDDVHNYLESCNNHLSMLTGPSEDITFSSL
IKDIKKILNSLVWNIKLSLINFGILSPSASSTPLTDSESYRRFEAAQRDLDAAEENEKSL
EKEHTKLMHELEYHHGWDLYRAIKGMETKREIGGYTYKVVFYENVFQDSILLGNFASQEG
NVLKYENGQSCWNGPHRSAIVTVECGVENEIVSVLEAQKCEYLIKMKSPAACSPDQLKQS
LLNTQNSANENAVNGMEDKESSVDEL
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgaagttcagtcaatggtacacgttgactgcacctttgttgatcagttcattgtataca
gtaaatgctgcaaatgacctccgtggtgtagcaagtgataaatcggacttgtacaagcca
gatgccaaaggaaactggaaatgcttgggaagtgataagttaatatcatttaatcaagtc
aatgacgattattgtgattgccctgacgggtcagatgaaccaggtacatctgcttgtcac
aatggtaaatttttttgtaaaaatacaggatacatcagttcatatatcccatcaaatcgt
gttgacgataccgtgtgtgattgctgtgacggttctgatgaaagtcttattaaatgccct
aatacttgtgcccaaaaggctcgagaatacttggcaacattagaagagcataatagactt
gtaaaaaatggactaaaaattcgcgaacaatgggctttagaaagcgcaaaaaaaacagac
gaagtaaaggctcgatacaaagaaattagcgatagtttagttgccgtttccgctgagaaa
acccaattatctgagaaggtggagaagatgaagcgttcaacggatttaggtgctgaagcc
gtgttgcccttagattttcaagatttgagggtagcgctactttcacttgtcgatgagcgt
aatgaaatgcaagaaagacttgatattttgactaatcttctcgatgaactaacacttcta
tatgaaacggataaatttgatgaaactatgaaagaagcaatactttcttttgaagatctt
aaagagcaagaaatcagaagaaaggtgagctccgatgatgttcataactatctcgagtca
tgtaacaaccacctttcaatgctaacagggccttctgaagatattactttttcttctttg
atcaaggacatcaaaaaaattttaaattcactcgtttggaacatcaaactctcacttatc
aattttggaatattaagtccatctgcctcctcaactcctttgactgacagtgaatcatat
cgccgttttgaagcagctcaacgtgacctagatgctgctgaagaaaacgaaaagagtctt
gaaaaggaacacacaaaacttatgcatgaattggaataccaccatgggtgggatttgtac
agagctatcaagggaatggaaacaaaacgtgaaattggtggctatacatacaaggtggtg
ttttacgaaaatgtttttcaagattccattctattaggaaattttgcctcgcaggaagga
aatgttctaaagtatgaaaatggtcaaagttgctggaatggtcctcatagatctgccatt
gttactgttgaatgtggagtagaaaatgagattgttagtgtactggaggctcagaaatgt
gagtatttaatcaaaatgaagagccctgctgcgtgctcccctgatcaactcaagcagtct
ttactcaacacccaaaacagcgcaaacgaaaatgctgttaatggaatggaagacaaggaa
tcatctgtcgatgagttataa

DBGET integrated database retrieval system