KEGG   Schizosaccharomyces pombe (fission yeast): SPCC830.06
Entry
SPCC830.06        CDS       T00076                                 

Definition
(RefSeq) putative calcineurin regulatory subunit B
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPCC830.06
Protein phosphatases and associated proteins [BR:spo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SPCC830.06
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 Dynein_attach_N ToxS
Other DBs
NCBI-GeneID: 2538786
NCBI-ProteinID: NP_588476
PomBase: SPCC830.06
UniProt: Q9UU93
Position
III:join(2192204..2192255,2192449..2192685,2192748..2192860,2192914..2193036)
AA seq 174 aa
MGQSQSQIFEDLISNSSFSNEEIERIRKRFIKIDANQSGSIDRNEFLSIPSVASNPLASR
LFSVVDEDGGGDVDFQEFINSLSVFSVHGNKEEKLKFAFKIYDIDRDGYISNGELYLVLK
MMVGTNLREDQLQQIVDKTIMEVDKDRDGKISFEEFKDIVSGSNVTSSMTLDSF
NT seq 525 nt   +upstreamnt  +downstreamnt
atgggtcagtcgcagtcgcaaatctttgaggacttgatctcaaattcatccttttccaat
gaggagatagaaagaattcgcaagcgttttattaaaatagatgctaaccaatctggctct
attgaccgaaacgaatttttgtcgattcccagtgtagcttctaacccacttgcttccaga
ctgttttcagttgtagacgaagacggtggaggagatgtggactttcaagaatttattaat
agcctttctgtattttcagtgcatggcaataaagaggaaaagctgaagtttgccttcaag
atttatgatattgaccgtgatggttatatttcaaacggagaactttatctagttctgaaa
atgatggttggcacgaatcttcgggaagatcaattgcagcagattgttgacaaaaccatt
atggaagttgataaggatcgcgatggaaaaattagctttgaagagttcaaagatattgtc
agcggttccaacgttactagtagcatgacactcgattctttttga

DBGET integrated database retrieval system