KEGG   Schizosaccharomyces pombe (fission yeast): SPCC830.09c
Entry
SPCC830.09c       CDS       T00076                                 

Definition
(RefSeq) putative Rnase P/MRP subunit
  KO
K03537  ribonuclease P/MRP protein subunit POP5 [EC:3.1.26.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03008  Ribosome biogenesis in eukaryotes
spo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    SPCC830.09c
   03008 Ribosome biogenesis in eukaryotes
    SPCC830.09c
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPCC830.09c
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPCC830.09c
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPCC830.09c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     SPCC830.09c
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     SPCC830.09c
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    SPCC830.09c
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    SPCC830.09c
SSDB
Motif
Pfam: RNase_P_Rpp14
Other DBs
NCBI-GeneID: 2538895
NCBI-ProteinID: NP_001342905
PomBase: SPCC830.09c
Position
III:complement(2199274..2199693)
AA seq 139 aa
MVRFKSRYLLFEVLYPEAKEFFDYPTIPSDSSITTSSLSKIIRTMVAENFGDVGIGKVAS
SLTVKYFSPNTSTGILRVSRQHFRLAWAALVLIRELYGKPVIIRVVRVSGTIKKAELAAI
ERNKSEIHNISLMDEPIEV
NT seq 420 nt   +upstreamnt  +downstreamnt
atggttcgcttcaaatcccgatatttactttttgaagtattatatcctgaagcaaaagag
ttttttgactatcctactatcccttctgatagttctataactacgtctagtctttctaaa
ataattagaaccatggttgcagaaaatttcggtgatgttggtattggaaaggttgcatct
agtctaactgtaaaatatttttcacctaatacatctactggcattctgcgggtctcaaga
cagcattttcgtttggcatgggccgcattagttttaataagggaattatatggcaagcct
gtaataattcgcgtggttcgtgtatctggtacaataaaaaaggcagaattagctgccatt
gaacgaaataaatcagaaattcataacatctctctgatggatgaacctattgaagtttaa

DBGET integrated database retrieval system