KEGG   Schizosaccharomyces pombe (fission yeast): SPCC895.05
Entry
SPCC895.05        CDS       T00076                                 

Gene name
for3
Definition
(RefSeq) formin For3
  KO
K11238  cytokinesis protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    SPCC895.05 (for3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPCC895.05 (for3)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    SPCC895.05 (for3)
SSDB
Motif
Pfam: FH2 Drf_FH3 Drf_GBD REV1_C
Other DBs
NCBI-GeneID: 2539487
NCBI-ProteinID: NP_588046
PomBase: SPCC895.05
UniProt: O94532
Position
III:1003130..1007515
AA seq 1461 aa
MASKMPEGSPPTSRSIQSRNSSYSTSSNERIGTPSTISLSENSDLSKLQSTNDFESREDL
SLTSDDNNDPEYVMCYNTVYHQKTKINDKLLSETEQLRKIYPLESRVFPKPTIVKEITNE
RTKRYTFYDDDAPLTNQHTVLDEATYNRILKRIDFFIEKVVEVPPTYHFLSLLNVQLRIQ
PIWWMDEFAERNGIESLLSALRNLGHYPERASKTPLESQIIQSLFHCLNSENCRRRYQSS
AKCSVPGFNALGTIAETVLSKSLNSARMATFLLKFLCNKKGLSYFKAVIRAFEWLVEQKL
SKTRFSAWMHSFNDVITGVRVCADSSPQAIVHMDEFEDTDCLIDYLVATLALIRDLCAAP
PDLQLRCALRHELLSAGLQKAIDSLLKWRNRHVRDALQLLIKEHNADARRFRSGSDVNNV
DRKCVKKQMNYREESHTPHGNTTRKTSTPVSNNRPTTPEQQAVWDVFQRIYTRFTGSEGS
KESFIKLLEYFVTEPDNGKIQKSMQLLTHTLEALEGFKTAKADTNVGLTILSQRLLDKLG
TAEEIAEYKTKYNGAMLENKHLKEQVESMLSQLNVGPRDPMQFLKKQLDELKAELNLRDN
LLASMQREFETRYRAQIQAYNKLQSQMEHVQNSNEQHLQPGLLNKVSKSFDSVHRRNLSQ
DSLDAMTEQFSYHVEPNILSGSGIPVRVHTPSKTEDLDESFSGSEISSSPSPLLPDVSDT
VEEQQKLLLKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP
PPPAVSAGGSRYYAPAPQAEPEPKIDETSLTEEQKIQLEEARKQRKAADDAARAAIEKYT
SIPSLRDLHKPTRPLKRVHWQRVDPLPGPNVFTKFCLNFDITAKVFIDNGLLDFLDEKFD
NTPREDFVAVEISDQRSSLLPDTVEQNMAIILRSVSNMPVEDLVQKFLVEPDFLPASILY
FDRASLASTNAYTDPFIPYSTDYTKKNPKEPTADVNSLSYFEKFFVLFVVNLRHYFQERM
KALKFRSTLFGDLEILEVRMKEVIDTSDSIMEDKNFAEFFQVLLIIGNYFNEPYDRASAF
SLYMIYRLETLRDSSSALTLMHYFDEIIRTRFPELLQAESTFKKIQSVSGYNIDAMVAGV
DGAYDEFCDFQTSLKDGALSKCDQHHPDDKAYDILSEWLPEAKERIRNIKKLKTDMLTKL
ENTVKYLCEYDSIDKVRNSFFKNLNSFYEMYSIAKAENEERFEKEKRRIMSEDRDKLIRG
RQKTSIVAKYRNKRELPEDSDDKQDTASKDKNSLETIDEKMEDASKIEGDAKTGDDNEME
DLDKMEDLEKPDYAEEKDPYITVMSELRSRIQNVPKRTVTVYSDEGVATLEPGAQGDDVV
DKAKMILEKMEGHSQLLTSSANPDEEVLRAKLKAAERLQKPAIPRTRRKGHTEPKSAKSL
LAELTNGSNASNLVENDRQKQ
NT seq 4386 nt   +upstreamnt  +downstreamnt
atggcatctaaaatgcctgaagggtctccccctactagtcgttctattcaatctcgaaat
tccagttactctacctcttccaacgaacgtattggaacaccctctacgatttccctatct
gaaaattcagatctttctaaattacaaagtactaatgattttgagtcgcgagaagatctc
tctcttacttccgatgacaataatgaccccgaatatgttatgtgctacaacactgtttat
caccaaaagacaaaaataaatgataaacttttatccgaaactgagcagttacgtaaaatt
tatcctttagaatcccgtgtatttccaaaacctaccattgttaaagagattaccaacgag
cgaaccaagcgctacactttttatgacgatgatgctcctcttactaaccaacatactgtt
ttagatgaagcaacttataatcgaattttaaaaaggatagactttttcattgaaaaagtc
gttgaagtcccacctacttaccattttttatcgctattaaacgttcaattacgtattcaa
ccaatttggtggatggatgaatttgctgaaagaaatggtattgaaagtttactgtctgct
ttaagaaacctgggtcactatcctgaacgtgcatctaaaacacctcttgaatcccaaata
atacagtcattatttcactgtttgaacagcgaaaactgccgtcgtcgttatcagtcttca
gctaaatgctctgttccaggatttaatgctctaggtactattgctgagactgtgctttca
aaaagtttaaattcagctcgcatggctacttttctccttaaattcctttgtaataaaaag
gggttgagttacttcaaagctgtaatcagggctttcgaatggctcgtcgagcaaaagtta
tcaaaaactcggtttagcgcatggatgcattcctttaatgatgtgattactggtgtccga
gtttgtgctgattcatctcctcaagcgattgttcacatggacgaatttgaagatacggac
tgcttgattgattaccttgttgcaactttagctctcattcgagatttatgtgctgctcca
ccggatttgcaacttaggtgtgctctaaggcatgaattgttatctgctggtcttcaaaag
gccatcgactctttgttaaaatggagaaacagacacgtccgtgatgctctgcaattacta
atcaaagagcataatgcagatgctcggcgtttccgaagtggtagtgatgtgaataatgta
gataggaaatgcgtaaagaaacagatgaactatagagaagaatcacatacacctcatgga
aatactactcgaaagacctctactcctgtatctaataatcgacccacaactccggaacaa
caggctgtttgggatgtttttcaaagaatttatactcgctttacgggaagtgaggggtct
aaagaaagtttcattaaactactcgagtattttgtgactgaacccgacaacggaaaaatt
caaaaaagtatgcagttattgactcacacgcttgaggcactggaaggtttcaaaactgcc
aaagcagatactaatgtcggtctaacgatcctatctcaaagacttttagacaaacttggt
accgcagaggagattgcagagtacaagacaaagtataatggagccatgcttgaaaacaag
catctgaaagaacaagttgaatctatgctttcccaattgaacgttgggccccgcgaccct
atgcagtttctgaagaaacaattggatgaattgaaagctgaattaaatcttagagacaat
ctcctcgcatccatgcagcgcgaatttgaaacgcgttatagagctcaaattcaagcatac
aataagttgcaatcccaaatggaacacgtgcagaattcaaatgagcagcacttacaaccg
ggcttacttaataaggtttcaaaaagttttgacagtgttcatagaagaaacctttctcaa
gattctctagatgcgatgaccgaacagttttcttatcatgttgagccaaatattttaagt
ggaagtggaattcctgttcgtgtacatacaccatccaaaactgaagatttggacgaatct
ttctccggaagtgaaatatcttcctcgccttcgccattgctaccagatgtttccgacacc
gtagaagagcagcaaaagttattacttaaatctcctcccccaccacctcctgctgtaata
gttccaacaccagctccagctcctattccagttcctcctccagctcctattatgggtgga
cctccaccacctcctcctccacctggtgtagcaggagccggacctccacctccaccacct
ccaccccctgctgtttctgctggtggaagccgatattatgctccagcaccgcaggcggag
ccagagcctaagattgacgaaaccagcttaacagaagaacaaaagattcaacttgaagag
gccagaaaacagcgtaaagctgctgatgatgcagcgagagcagccatagaaaagtataca
agtatccctagtcttcgtgatcttcacaagccaactcgtcctttgaagcgcgtccattgg
caacgggttgatccactgcctggaccaaatgttttcacaaagttctgcttaaattttgac
attaccgctaaagtttttatagataatgggcttctcgattttttggatgagaaatttgat
aacactcctagggaagattttgttgcagtggaaatttctgaccaacgatcttctctttta
cctgatacagttgaacaaaatatggctattattttgcggtctgtatctaatatgccagtg
gaggacttagttcaaaagtttttagtcgaacccgactttttaccggcctcaattttatac
tttgaccgcgctagccttgcatctaccaatgcctataccgatccattcattccttatagt
acggattacacaaagaaaaatccaaaagaaccaacggcggatgtgaacagtttatcttat
tttgagaaattttttgtattgttcgtcgttaaccttcggcactatttccaagaaaggatg
aaagctctaaaatttcgctcgacgttgtttggtgatttggaaatacttgaagttcgtatg
aaagaagtcattgacacttcggacagtattatggaggataaaaattttgctgaattcttt
caagtcttactgattattggcaactattttaatgaaccttatgatcgagcatctgcattt
tccttgtatatgatatatcgccttgaaactttacgagatagttcctcagctctaactttg
atgcactactttgatgagattatacgaactcgtttccctgaattattgcaggcggaatcc
acgtttaaaaaaattcagagtgtttccggatacaatatagatgctatggttgcgggtgta
gatggtgcttatgatgaattctgcgactttcaaacgtctctcaaagacggtgctctatcg
aaatgcgaccagcatcatccagatgataaggcgtacgatattctttccgaatggttgcct
gaggctaaagaaaggattaggaatattaaaaagcttaaaactgatatgctcactaaactt
gaaaacactgtgaagtatctttgtgaatatgactccattgataaggttagaaactctttc
ttcaaaaacctgaattctttttatgaaatgtattccatcgccaaagcagagaatgaggaa
cgttttgagaaggagaaaagacgaatcatgtcggaggatcgtgacaaactgattcgtggt
cgccaaaagacatccattgtagcaaaatacagaaataaaagagagttaccagaagactct
gatgataaacaagatacggcctccaaggataaaaattccttagaaacaattgatgaaaaa
atggaagatgccagtaaaatagaaggtgatgctaagaccggagatgataacgaaatggaa
gatcttgataaaatggaagaccttgaaaaaccagattatgctgaagaaaaagatccatat
ataactgtaatgtcagaattacgatctcgtatacaaaatgtccctaaaaggactgttact
gtttattccgatgaaggcgttgctacacttgagcccggagctcaaggggatgatgttgta
gataaggccaaaatgattcttgaaaaaatggaaggacattcccaactattaacttcttcg
gcaaatcctgatgaggaggttttacgtgccaaactgaaagctgctgagcgtttgcaaaaa
cctgcaattcctagaacacgccgtaaaggccacactgaaccaaagagtgctaagtcacta
cttgcagaactaactaacgggtctaatgcttcaaatctagttgaaaatgaccgccaaaaa
caatag

DBGET integrated database retrieval system