KEGG   Schizosaccharomyces pombe (fission yeast): SPCC895.09cHelp
Entry
SPCC895.09c       CDS       T00076                                 

Gene name
ucp12
Definition
(RefSeq) putative ATP-dependent RNA helicase Ucp12
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD RWD AAA_19 AAA_22 UBA ATPase T2SSE ABC_tran PhoH AAA_30 AAA_29
Motif
Other DBs
NCBI-GeneID: 2539263
NCBI-ProteinID: NP_588050
PomBase: SPCC895.09c
UniProt: O94536
Position
III:complement(join(1017094..1018002,1018046..1020066,1020108..1020708,1020768..1020956,1021028..1021291))
Genome map
AA seq 1327 aa AA seqDB search
MGSKGKKGKSSEVNLETSKNKEKNIKGKKKNSLDPIEKNKQETAGLQTTSRPTAKQLVGG
SSWTGKIPVVLLNEHCQRSKWEKSDVKVRQTKSKNYIFTSVVLAKKDPKNPSILDHVSLI
PPKSYYENGYFPEKETLVEARNVGAVYALHRIMSHKSLQHALPPEHRNIWFDMEKQKKEE
LKNKHSWLYNEDPFKAAKELQAARASSAAKPPPKASQKNEKVSLTSIKNTSLSHFSKFNF
KYALPIHMSLENRRSLENLFRNMNTWDILEDTKNLEPDTSIVNDLISLGFRDIHAKEACQ
YCVSLEDALEWLIIHVPEDDLPTRFLPSDYTTGISVQNLNSANLAIHYNAKRISETGYSF
DLCFSTLQTFENNIQISSEYLQQHLIGESFDGNISLEPNSTEWDDDVSALQSILDNKVSK
IENGCRVRIDYPTSEFGELFVDFRRPARSYPAHIPLMSLSSTKRMASYIKLSILKKMVVY
AMDLRGECMLSWLYNHLQENIEDFLQNIGSLLNISAATIGVSLSSQNKSAPTAKKNNSFK
PKLFRRSRELSEKLCNNWSERVKSPSYQLKVREREKLPAWESRRKIMDAIQHSQVVVISG
ETGSGKSTQVVQFILDHYLSSGEKDLQTVVCTQPRRISAISLAERVAFERDTTVGKEVGY
SVHGEKSISKETLLEFCTTGLLLRRIQQHGLGFLSTLSCVVVDEVHERSIENDILLTLLK
LVISRIPNLKVILMSATVNSDTFKYYFGNAGHLHIHGRTFPIKDYYIEDFAPKLNEDDDE
EDVPRRKKKEYEIDYHLISRLVSSIDAELGSSSGSILVFLPGVSNIARCIREIKSKDGSK
FEVLPLHASLNTSEQRRCFKTYTKRKIICATNIAETSITIDDVVAVIDSGRVKQIDYDVE
RDLVTFKETWASRAACQQRRGRAGRVKKGICYKLYTRGFEEKGMLGQTPPEVLRTALSQV
CLNVVPLVKRFSSAGNSVNQGSIKKFMNSLIDPPNDATVDLALKKLIQVGALTVSEDLTG
LGEYLVSLPIDLKLGKLLVFGSIFGYLEPALTITAILSTKSPFLGDDEAREIRSKQSQGW
GDVLADARVYHNWLEILETRGVKKTVQWCEEMHLHYTTLQQIRQNRNELSEAAQLLELTT
KKLTGNFDWYSTENLTVLSTLIAAALSPNVVKCVYPDKKFVASFSGSLEMEQEARLTKFY
DQNNQRLFIHPSSTMFVNSPNASRCTFVAYEQKVETTKPFLRNCTPINTYGMILLGANDI
LIDPLGKGLILDQAYCIKAWPKVVILLKMLKRCLDASLHERLESSSGLNYESEIHQCIRT
LIAGNGV
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atgggttcaaaaggaaaaaagggaaaatcatcggaggttaatttagaaacttcaaaaaac
aaggaaaaaaatatcaaagggaaaaagaaaaactcacttgatccaattgaaaaaaataaa
caggaaacagcaggcctgcaaacgacttcacgtcctactgccaaacagttagtaggagga
agctcttggactggaaaaattcctgtcgttttactaaatgaacattgccaaagaagtaaa
tgggagaaaagtgatgttaaggtgaggcaaaccaaatctaaaaattacatttttacttct
gtcgtacttgctaagaaggacccaaaaaacccttcgatattagaccatgtatctctgatt
cctcccaagtcctattatgagaatggctactttcctgaaaaagaaacgttagtggaagca
cgaaatgttggcgccgtttatgctttgcatcgaataatgtctcataaatcattacaacat
gcccttccacctgaacatcggaatatatggtttgatatggagaaacaaaagaaggaagag
ctaaaaaataagcacagctggctttacaatgaagatcccttcaaagcagccaaagaacta
caggcagcacgcgcttcttcagctgccaaaccaccgccaaaagcatctcagaaaaatgaa
aaggtctctttgacatctatcaaaaacacaagcctttcacacttctcaaagttcaatttc
aaatatgctcttcctattcacatgagtcttgaaaatcgtcgctctctagagaaccttttt
cgcaatatgaacacgtgggatatactagaggatacaaaaaatttagagcccgatacttct
attgttaatgatttaatttctttaggttttcgagacattcatgctaaagaagcttgtcag
tactgtgtttcccttgaagatgctttagagtggctaatcattcatgttccagaagacgat
cttcctacaagatttcttccttctgattatacaacaggaatatctgttcagaatctaaat
tcagcgaatctggccattcactacaacgctaaacggatttcggagacgggctatagcttt
gacttatgtttttctactcttcaaacttttgaaaataacattcaaattagttcagagtac
ttacagcagcatctaattggtgaaagctttgatgggaatatatctttggaaccaaatagt
accgaatgggatgatgatgttagtgctttgcaatctattttggataataaggtctcaaaa
atagagaatggatgtagagtgcgtattgactacccgactagtgaatttggtgagcttttc
gtcgattttagaaggcctgcccgttcgtatcctgcacacattcctttaatgtctctatcc
tctacaaaaagaatggcatcctatattaagttgagtattcttaaaaagatggttgtttac
gcaatggatcttagaggtgaatgcatgttatcctggttgtataatcatcttcaggaaaat
attgaagactttttacaaaatattggaagcttactaaatatttcagctgcaacaattggt
gtctctttatcctctcaaaacaagtctgcgccgactgccaaaaagaataacagtttcaag
ccaaaattatttcgccgttcgcgcgaattatctgaaaaattatgtaataactggagtgag
agggttaaaagtccttcatatcaattaaaagttcgtgaacgtgagaaactccctgcatgg
gaatcaaggagaaaaattatggacgccatacagcattctcaagttgttgttataagtggt
gaaactggtagtggaaaatcaacacaagtagttcaatttatcttggaccattatctttct
tctggagaaaaagatttgcaaacagttgtttgtacacagccaaggagaatatctgcgata
agtttggcggaaagagttgccttcgaacgtgatacaactgttggaaaagaagttggttac
agtgtacatggtgaaaaatccatatctaaagaaacccttcttgagttttgcactacaggt
ttgcttcttagaagaattcagcaacatggtctaggctttttgagtactttatcttgtgtt
gttgtagatgaagtacatgaaagatccatcgaaaatgatatactcttaacacttttgaaa
ctagtaatttctcgtatcccaaatttgaaagtcattttgatgagtgccacggtgaactcc
gatacattcaaatattattttggaaatgctggtcatttacatattcacggccgtactttt
ccgatcaaggattactacattgaggattttgcgcctaagctaaatgaagatgatgacgag
gaagacgttcccagaagaaagaaaaaagaatatgaaattgattatcatcttatttctaga
cttgttagttctattgatgctgaacttggttcctctagtggttctatattggttttcctt
cccggtgtctcaaacatagctcgttgtattcgtgaaataaaatcaaaagacggctcaaaa
tttgaggtcctcccattacatgcctctttgaatacttcggagcaaaggagatgtttcaaa
acatacacaaagcggaagatcatatgtgcaacaaatattgcggagacttcaattactatt
gatgatgttgttgccgttattgacagcggcagagttaagcaaattgattatgatgttgaa
cgagatctggtgacttttaaagagacttgggcctcaagagctgcttgtcaacaacgccgg
ggtcgggcgggtcgtgttaagaaaggaatatgttataagttatatacaagaggatttgaa
gaaaaaggaatgctaggccaaacacctcccgaagttttacggacggctttaagtcaggtt
tgtcttaacgtagttcctttggtcaagagattttcttctgctggtaattctgtgaaccag
ggttcaatcaaaaaatttatgaacagccttattgatccaccgaatgatgcaacggtagac
cttgctttgaaaaaactaattcaagtcggtgctctcaccgtgtcagaagatttaactggt
ttaggagaatacttagtgtcattacccatagatctaaagcttggaaagcttttggtgttt
ggttcgatctttggatatttggaacctgcgcttactattacagctattctctctacaaag
tctcctttcttaggagacgatgaagctagggaaataaggagtaaacaaagtcaaggatgg
ggagatgttttggctgatgctcgagtatatcacaactggctcgaaatactagaaaccagg
ggtgtaaagaaaacagttcagtggtgtgaagagatgcatcttcattacacaacgttacaa
caaattcgacagaatcgaaacgaattgagcgaagctgcacagctacttgaactaactact
aaaaagctgactggtaactttgattggtattcaactgaaaacctgactgttctatcgact
ctaattgctgctgctttaagtcccaatgttgtgaaatgtgtttatcctgataaaaaattt
gttgcttcattttctggatcgcttgaaatggagcaggaagctcgcctgacgaagttttat
gatcaaaacaaccaaaggttattcatacatccttcaagtactatgtttgttaattctcca
aatgcttcaagatgtacgttcgtggcatatgagcaaaaggtagaaaccacgaaacctttc
cttagaaattgtacacctatcaatacatatggaatgattttgctgggagcaaatgatata
ctcattgatcctcttggtaagggattaatacttgatcaagcatattgcattaaagcgtgg
cctaaagtcgttattttattaaaaatgctaaaaagatgtcttgatgcctcattacatgag
cgattggaatcttcgtcggggttaaactacgaaagtgaaatacatcaatgtattcgtact
ctgattgcaggcaacggtgtttag

DBGET integrated database retrieval system