KEGG   Schizosaccharomyces pombe (fission yeast): SPCC965.05c
Entry
SPCC965.05c       CDS       T00076                                 
Symbol
thp1
Name
(RefSeq) uracil DNA N-glycosylase Thp1
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SPCC965.05c (thp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC965.05c (thp1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     SPCC965.05c (thp1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SPCC965.05c (thp1)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 2539432
NCBI-ProteinID: NP_588515
PomBase: SPCC965.05c
UniProt: O59825
Position
III:complement(2290888..2292169)
AA seq 325 aa
MNDIETRDTGTKNDNSSEFNLSVKSHKRKRSFDDENLELEESREETSGGILKKAKTQSFS
ESLERFRFAHAGSNNEYRKTDVVKNSDTDNGLLKSAVETITLENGLRNRRVNVTKKSTLK
ASVKKSTLKKKNEVDPALLQGVPDYICENPYAIIVGLNPGITSSLKGHAFASPSNRFWKM
LNKSKLLEGNAEFTYLNDKDLPAHGLGITNLCARPSSSGADLRKEEMQDGARILYEKVKR
YRPQVGLFISGKGIWEEMYKMLTGKKLPKTFVFGWQPEKFGDANVFVGISSSGRAAGYSD
EKKQNLWNLFAEEVNRHREIVKHAV
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaacgacattgagacgagagacacaggaacgaagaatgataacagctcagaatttaat
ttatcggtaaaaagtcacaaaagaaaaaggagttttgatgacgaaaatttggagctcgaa
gagagtcgtgaagaaaccagtggtgggattttgaagaaggcgaaaacccaaagtttctcg
gagtctctagaacgattccgctttgctcatgcaggaagcaataatgagtatcgtaaaaca
gatgtcgtgaagaattctgatacagacaacgggttgttaaagtcagcggttgagacaatt
acgcttgaaaatggcttaagaaatcgtagggttaatgtaactaagaaaagtaccctcaaa
gcatctgttaagaaaagcacgcttaaaaagaagaatgaggtggaccctgcgttattgcag
ggggttccagattacatttgcgagaatccgtatgccatcattgtcggactcaatccaggt
attacttcttctcttaaaggacacgcatttgcttcacctagcaatagattttggaaaatg
cttaataaaagcaaacttttggagggaaatgccgaattcacgtaccttaacgataaagat
ttacctgctcatggtttaggtataactaatctttgtgcgagaccttcgtctagtggagcg
gatctacgcaaagaggaaatgcaagatggtgctcgtattctttatgaaaaggttaagcgg
taccgtcctcaagtaggcttgttcatttccgggaaaggcatatgggaggaaatgtataaa
atgcttacaggaaaaaaattgcccaagacctttgtttttggatggcagccagagaaattt
ggggatgcaaacgtgtttgtcggtattagctcgagtggccgtgctgcaggctactctgat
gaaaaaaagcaaaatctttggaacctttttgccgaagaagtgaacaggcatcgagaaata
gtgaaacatgcagtctaa

DBGET integrated database retrieval system