KEGG   Schizosaccharomyces pombe (fission yeast): SPCC965.11c
Entry
SPCC965.11c       CDS       T00076                                 

Definition
(RefSeq) putative amino acid transporter
  KO
K16261  yeast amino acid transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPCC965.11c
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPCC965.11c
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 2539173
NCBI-ProteinID: NP_588521
PomBase: SPCC965.11c
UniProt: O59831
Position
III:complement(2304137..2305750)
AA seq 537 aa
MEAAPSEKVPAKKLSSSENLDIGVSEVVTVDAAENNSNGIKRGLKTRHVSMMALAGIIGP
GVFIGMGSALHIGGPVGLIVGFAIVSIVVFGVMLSIGEFNSLFDFNFNTHAARWVDPAFG
AAIGWNYVIVWLTNIAAEYTSLTSILQYWGPHVPSYGFFLIFWGFFTCYQMLGVSVFGES
EYILAFIKLLFITGFYIFAIIYAAGGIPHHKPPNLFKEMPLAHGFGGIVSAFVYAGVFFS
GVESVSMTAAESKNPKKAIPLAVRQTFWRILYVYFGISISYGITVAWNDPNLSSGSKTLK
SPMTIAIMNAGWNHAGDFVNAVILITCLSSINSGIYIGSRSLYNLAKDGMAPKIFKRVDK
RGVPWVAVHSVHLFGFLSIMNYSTGAVKAYGYIINLAGVSAFIVWTAIIFVHFRFRRGWV
KQGYALSDLPFKSPLYPFPQLIGFVIGIILTLVQGWTVFKPFAAGDFVDAYILLPLFFVI
WLSYKFIKKTKWVSYEDMDFINGRRVIEPTYSNEQSSDKETEDGKKTSFWNRVWKEV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggaggcagcgccttctgagaaagttcctgccaagaagctatcctcctcagaaaacctc
gacattggagtttccgaagttgtaacagttgacgcagcggaaaataattcaaatggaatc
aaacgtggattgaagactcgtcatgtatcgatgatggcccttgctggtatcatcggtcca
ggtgtcttcattggtatgggcagtgccctgcatattggtggtccggtgggtctaattgtc
ggctttgccatcgttagtattgttgtttttggggttatgctgagtatcggcgagtttaat
tcgctatttgatttcaacttcaatactcatgctgctcgatgggttgacccagcatttgga
gccgctatcggatggaactatgttatcgtatggcttaccaacatcgcagcagaatataca
tctttaacatctattcttcaatattggggcccccatgtgccatcttatggcttttttcta
attttttggggtttttttacgtgttaccaaatgctaggtgtgtcagtgtttggagaatct
gaatacattttggctttcattaaacttctatttattactggattctacatatttgcaata
atttacgcagctggaggaattcctcatcataagccgcccaacttgtttaaagaaatgcca
ttggcacacggatttgggggtatagtttcagcatttgtatatgccggtgtcttttttagt
ggtgtagaatctgtatctatgactgcagctgaaagcaaaaatccaaaaaaagctatcccg
cttgctgtgagacaaacgttctggagaatcttgtatgtctattttggtatctcaatctct
tacggtatcaccgtagcatggaatgacccaaatctttcgtcaggctccaaaactctcaag
tctccaatgacaattgctataatgaatgccggttggaatcacgcaggtgattttgtcaat
gcagtcattttaattacttgcctttcttccatcaacagtggtatatatataggaagtcga
tctttgtataatttagccaaggatggcatggctccaaaaatttttaaaagggttgataaa
agaggtgtaccatgggttgcggtccactcagtccaccttttcgggtttctttccattatg
aattacagcacaggtgctgtcaaggcatatggctatattatcaatttagctggtgtgtct
gcattcattgtgtggacagcaatcatattcgttcactttcgtttcagacgaggctgggta
aagcaaggctatgccttgtctgatttaccgtttaaatcacctctttatccctttccccag
cttataggattcgttataggaatcattctcacactagtacaaggatggacggtttttaaa
ccatttgctgctggcgattttgtcgatgcctatatacttctacccctgtttttcgtcatt
tggctatcttataaatttattaaaaagacaaagtgggtatcttatgaagacatggacttc
ataaacggcagacgagttattgaaccaacctattcaaatgaacagtcttcagataaagaa
accgaagacggcaaaaaaacaagtttctggaacagagtttggaaagaagtataa

DBGET integrated database retrieval system