KEGG   Schizosaccharomyces pombe (fission yeast): SPCC970.01
Entry
SPCC970.01        CDS       T00076                                 
Symbol
rad16
Name
(RefSeq) DNA repair endonuclease XPF
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPCC970.01 (rad16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPCC970.01 (rad16)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC970.01 (rad16)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     SPCC970.01 (rad16)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    SPCC970.01 (rad16)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     SPCC970.01 (rad16)
SSDB
Motif
Pfam: ERCC4
Other DBs
NCBI-GeneID: 2538760
NCBI-ProteinID: NP_587855
PomBase: SPCC970.01
Ensembl: SPCC970.01
UniProt: P36617
Position
III:complement(514796..518379)
AA seq 877 aa
METKVHLPLAYQQQVFNELIEEDGLCVIAPGLSLLQIAANVLSYFAVPGSLLLLVGANVD
DIELIQHEMESHLEKKLITVNTETMSVDKREKSYLEGGIFAITSRILVMDLLTKIIPTEK
ITGIVLLHADRVVSTGTVAFIMRLYRETNKTGFIKAFSDDPEQFLMGINALSHCLRCLFL
RHVFIYPRFHVVVAESLEKSPANVVELNVNLSDSQKTIQSCLLTCIESTMRELRRLNSAY
LDMEDWNIESALHRSFDVIVRRQLDSVWHRVSPKTKQLVGDLSTLKFLLSALVCYDCVSF
LKLLDTLVLSVNVSSYPSNAQPSPWLMLDAANKMIRVARDRVYKESEGPNMDAIPILEEQ
PKWSVLQDVLNEVCHETMLADTDAETSNNSIMIMCADERTCLQLRDYLSTVTYDNKDSLK
NMNSKLVDYFQWREQYRKMSKSIKKPEPSKEREASNTTSRKGVPPSKRRRVRGGNNATSR
TTSDNTDANDSFSRDLRLEKILLSHLSKRYEPEVGNDAFEVIDDFNSIYIYSYNGERDEL
VLNNLRPRYVIMFDSDPNFIRRVEVYKATYPKRSLRVYFMYYGGSIEEQKYLFSVRREKD
SFSRLIKERSNMAIVLTADSERFESQESKFLRNVNTRIAGGGQLSITNEKPRVIVDLREF
RSSLPSILHGNNFSVIPCQLLVGDYILSPKICVERKSIRDLIQSLSNGRLYSQCEAMTEY
YEIPVLLIEFEQHQSFTSPPFSDLSSEIGKNDVQSKLVLLTLSFPNLRIVWSSSAYVTSI
IFQDLKAMEQEPDPASAASIGLEAGQDSTNTYNQAPLDLLMGLPYITMKNYRNVFYGGVK
DIQEASETSERKWSELIGPEAGRRLYSFFRKQLKDYE
NT seq 2634 nt   +upstreamnt  +downstreamnt
atggaaacaaaggttcatttgcctcttgcttaccagcagcaggtttttaacgaacttatt
gaagaggatggtctgtgtgtaattgcaccaggtttgtcattgctacaaattgcagcaaat
gtactctcatattttgcagttccaggatcccttcttttgcttgttggagcaaacgttgat
gacattgaattgattcaacatgaaatggaaagccacttggaaaaaaaattgattactgta
aatacagaaactatgtcggttgacaaacgagaaaagtcttatctagagggtggtattttc
gccattacaagccgcatattagtgatggatttgttgacaaaaattattccaacagaaaaa
atcactggaattgtattattacatgcagatagagttgtctctactggaacggtagcgttc
ataatgcgattgtatcgtgaaaccaataaaactgggttcattaaagcttttagtgatgat
ccagagcaatttttgatgggaataaatgctctcagtcattgcctaagatgcctgtttctt
cgacatgtatttatatatcccagatttcatgtagttgtggcagagtcccttgaaaaaagc
cctgcaaatgtggtagagttgaacgttaacctaagtgattcccaaaaaacaattcagtca
tgcctattaacctgtatagaaagtacaatgagagaattacgaagactaaattctgcttat
ctggatatggaggattggaatatcgagtctgccttacatcgtagttttgacgttatagtg
cgaagacaactagattctgtatggcacagagttagcccaaaaaccaaacagttggttgga
gatctctcgactcttaagtttcttctcagtgctcttgtttgttatgactgtgttagcttc
cttaaactcttagataccctcgttttatctgtaaatgtttccagctacccatctaatgca
caaccttctccttggcttatgttggatgccgccaataaaatgatccgtgtcgctagagac
cgagtatacaaagaatcagaaggaccgaatatggatgcgattcccattttggaggaacag
ccgaaatggtctgtcttgcaagacgtattaaacgaagtgtgtcatgaaacaatgttagca
gatacagatgcagaaacatccaataattcgataatgattatgtgcgcagatgagcgtact
tgtttacagttacgtgattatttgagtacggtgacttacgacaataaagactctttgaaa
aatatgaatagcaaattagtggactattttcaatggagagaacaatatagaaagatgagt
aaatcaatcaagaaaccagagccttccaaggagcgagaggcttctaatacaacgtctaga
aaaggtgttccaccttcaaagagaagaagggtaagaggtggaaacaatgccacttcacgc
acaacttctgataatacagatgcgaatgattcttttagtagggatttacgcctagagaaa
attctgctctcacacttatccaaacgttatgaacctgaagtgggcaatgatgcatttgaa
gttattgatgatttcaattccatctatatctattcctacaatggtgaaagagatgagtta
gtattaaataatttaagacctcggtacgttattatgttcgattctgatcccaattttatt
cgaagagtcgaggtttacaaagctacatatcccaaaagatctctaagggtttattttatg
tactatggaggatcgattgaggagcaaaaatatcttttttctgtaaggagagagaaagat
tcattctctcgtcttattaaagaacgatctaatatggctatcgtactgacggctgattcc
gaaaggttcgaaagccaagagtcaaagtttttaagaaatgtcaatactcgtatagctgga
ggaggacagttatcgatcacaaatgagaaacctagggttatcgttgacttgagggaattc
cgtagttcgttaccttccatattacatggaaataatttttctgttatcccttgccaactc
ttagtgggagattatatattatcaccaaagatctgtgttgaaaggaagtcaattagagat
ttgatccaatcattaagcaatggccgtctttattcccaatgtgaagctatgactgaatat
tatgaaattccagttttgttaattgaattcgaacaacaccaatcttttacatctccacct
ttctccgacctttcaagcgaaattggaaaaaatgatgttcaatctaaactggtactgtta
acattatcgtttcccaacttaaggattgtttggtcttctagtgcctacgttacatcaatt
atttttcaagatttgaaagccatggaacaagaaccagatcctgcttcagctgcctctata
ggtttggaagctgggcaagactcaacgaatacttataatcaagctccactcgacctgcta
atgggactcccatacataactatgaaaaactacagaaatgtgttttatggaggcgtgaaa
gatattcaagaagcttccgaaacctcagaaagaaaatggtcagaactaattggccccgaa
gcaggaaggcgtctttattccttcttccgaaaacagttaaaggactatgagtaa

DBGET integrated database retrieval system