KEGG   Schizosaccharomyces pombe (fission yeast): SPCC970.03
Entry
SPCC970.03        CDS       T00076                                 

Name
(RefSeq) putative cytochrome b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPCC970.03
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SPCC970.03
SSDB
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 2539526
NCBI-ProteinID: NP_587852
PomBase: SPCC970.03
UniProt: O74557
Position
III:complement(510435..511340)
AA seq 301 aa
MAKQTLLSTPLHGVYIPVFLIIFGTYIVKREWVGYAIVVAFSLGFHKFWRGRVRKVLSDK
IQQFELSDKAVLNHNTAIYRFRLPRANDVLGLPIGQHLKVFVDVDGKEYSRSYTPLSSDA
DKGYFDLLVKSYPNGKVSKKFSELKIGDTIGVRGPKGNWKHRTGLARHFGMIAGGTGITP
MLQIIRAVLSNFEDPTEITLLYANVSEGDIVLRDEIDALAKKDPRFTVHYVLNNPPENWK
GSVGFVTQELIKAHFPAPSPETKVLICGPTPMVNSLREATVALGYEKSRAISKLEDQVFV
F
NT seq 906 nt   +upstreamnt  +downstreamnt
atggccaaacaaactcttcttagtaccccgttgcatggagtctatattccagtgtttttg
atcatctttggtacttacattgtgaaacgcgaatgggtgggttacgctattgttgtggca
ttctctcttggttttcataagttctggcgtggacgcgttcgtaaagtattgagtgataaa
attcaacaatttgaacttagtgataaagctgtattgaaccacaacactgccatttatcgt
ttccgtctgcctcgcgctaacgatgttcttggtctccccataggacaacatttaaaggtc
tttgttgatgttgatggtaaggagtattccagatcttacactcctctgtcttccgatgct
gacaaaggttattttgatttgctcgtaaagtcttaccccaatggcaaagtgagtaagaag
ttttctgaacttaagattggtgataccatcggtgttcgtggccctaagggaaattggaag
catcgcactggcctcgcgcgccattttggcatgatcgcaggcggaacaggtattactcct
atgcttcaaatcattcgtgctgttctttctaattttgaagatccaacggaaatcactctt
ttatatgctaatgtatcagagggtgatattgttcttcgtgatgagattgacgcacttgct
aagaaggatcctcgttttaccgttcattatgttttgaacaatcctcctgaaaactggaag
ggaagtgttggatttgttactcaagaacttatcaaggcgcatttccctgctccttctcct
gaaaccaaagttcttatttgtggccctactcccatggttaattcactcagagaagctaca
gttgcattgggatatgaaaagtcccgagccatttcgaagcttgaggatcaagtatttgtc
ttttag

DBGET integrated database retrieval system