KEGG   Schizosaccharomyces pombe (fission yeast): SPCP1E11.10
Entry
SPCP1E11.10       CDS       T00076                                 
Name
(RefSeq) ankyrin repeat-containing protein
  KO
K06867  uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPCP1E11.10
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 2538792
NCBI-ProteinID: NP_588563
PomBase: SPCP1E11.10
UniProt: Q9UU77
Position
III:join(2408742..2408804,2408859..2408937,2408980..2409461)
AA seq 207 aa
MSTTTPNIWIAASDGKTDVVLKHLDSGISPNAADENGYTPIHAAVSYGHSDLLKILVERG
GDINIRDQDGETPLFVCEKLEIAHDLINQYNADTTVKNNDGLIAAQVIEANGEFPELAKY
LYSFTDLEPKDVNTLPNDTKIEYAKLMTEQEMDEEAGQPLLDQKAKAEIDRILALRDTGV
NVDDELRKILTGALSGHFERNVRPRSN
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagtacaacaactccaaatatttggattgccgcatcagatggtaaaacagacgtcgta
ttgaaacacctagattctggtatttcaccaaacgcagcagacgaaaatggatatacacct
atacatgcagcagtttcttacggtcattctgatttgcttaaaattcttgtcgaacgtgga
ggagatataaatattcgtgatcaagatggcgaaacacctctctttgtttgcgaaaaactg
gaaatagctcatgatttgataaatcagtacaatgcggacaccactgttaaaaataatgac
ggtttaattgcagctcaagttatagaggcaaatggagagtttcctgaacttgctaaatat
ctatactcttttactgatttggagcccaaagacgtgaataccttgcccaatgatactaaa
atagaatatgcaaagctcatgacagagcaagagatggatgaagaagctggacaacccttg
cttgatcaaaaagccaaggccgaaattgatcgcatattagctttacgcgatactggtgtt
aatgttgatgatgaacttcgtaaaatactgactggggctttgtctggtcactttgaaagg
aacgttcgtccacgctcaaattag

DBGET integrated database retrieval system