KEGG   Schizosaccharomyces pombe (fission yeast): SPCP25A2.02c
Entry
SPCP25A2.02c      CDS       T00076                                 
Symbol
rhp26
Name
(RefSeq) SNF2 family helicase Rhp26
  KO
K10841  DNA excision repair protein ERCC-6
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPCP25A2.02c (rhp26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCP25A2.02c (rhp26)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCP25A2.02c (rhp26)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    SPCP25A2.02c (rhp26)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      SPCP25A2.02c (rhp26)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII NPV_P10 FapA HU-CCDC81_bac_2 Prefoldin Snapin_Pallidin FERM_F2
Other DBs
NCBI-GeneID: 2539473
NCBI-ProteinID: NP_588091
PomBase: SPCP25A2.02c
Ensembl: SPCP25A2.02c
UniProt: Q9UR24
Position
III:complement(1178932..1182641)
AA seq 973 aa
MSVNEDLSHLGVFSVDQENLERDVTNTASEYIAHESREIEKKRLQKVRKEISSVKEKIRR
LDERIDSRLTKISVKENFRKQLSKFRDTLQSLQSDENDIKRRLNNEDSANAPGIGAFSTE
ELERQELIRTGKVTPFRNLSGLQKEVDFDDESSIREAVIKSEGTYYETAPHLSSEPSNID
HGIIPRDEKDEYVTVDAVTEKVVTAAIDDGDDLVYRQRLNAWCANRKELRDQASASENNK
DRGEFEGKDEWLLPHPSKKGQTFEGGFTIPGDIRPHLFRYQVTCVQWLWELYCQEAGGII
GDEMGLGKTIQIVSFLSSLHHSGKFQKPALIVCPATLMKQWVNEFHTWWAPLRVVVLHAT
GSGQRASREKRQYESDASESEAEESKTSIKLRGASSSFHRYAKNLVESVFTRGHILITTY
AGLRIYGDLILPREWGYCVLDEGHKIRNPDSEISISCKQIRTVNRIILSGTPIQNNLTEL
WNLFDFVFPGRLGTLPVFQNQFALPINIGGYANASNVQVQTAYKCACMLRDLISPYLLRR
MKLDVAADLPKKSEQVLFCKLTPLQRKAYQDFLQGSDMQKILNGKRQMLYGIDILRKICN
HPDLVTREYLLHKEDYNYGDPEKSGKLKVIRALLTLWKKQGHRTLLFSQTRQMLDILEIG
LKDLPDVHYCRMDGSTSIALRQDLVDNFNKNEYFDVFLLTTRVGGLGVNLTGADRVILFD
PDWNPSTDAQARERAWRLGQKKDVVVYRLMTAGTIEEKIYHRQIFKQFLTNKILKDPKQR
RFFKMTDLHDLFTLGDNKTEGTETGSMFLGSERVLRKDNSSRNGNEAEDIPARDRKKHKI
HDKGKKVNSSKVFEKMGIASMEKYKPPQESNVTKTNSDSTLGDDSVLDDIFASAGIQSTL
KHDDIMEASQTESILVEKEATRVANEALRAVSSFRRPPRQLIPPQQSTNVPGTSKPSGPI
TSSTLLARLKQRR
NT seq 2922 nt   +upstreamnt  +downstreamnt
atgagtgtcaatgaagatctatcccatttaggggttttttcggttgaccaagagaatttg
gaacgcgatgttacgaatactgctagtgagtacattgcacatgaaagtcgagagatcgaa
aagaagagacttcaaaaagtcaggaaagaaatatcttctgtaaaagaaaaaatacgtcgc
cttgatgagcgtatagacagtcgacttacaaaaataagtgtcaaggagaacttccgcaaa
caattatctaaattccgagacactcttcaaagtttacaatcagacgaaaatgatattaag
agaagacttaataacgaagattcggcaaatgcccctggtataggtgcattttcgactgaa
gaattggaaagacaagagctcatccgtactggtaaggttacaccgtttcgaaatctctct
ggactacaaaaagaagttgattttgatgatgaatctagcattcgtgaggctgttataaag
tctgaaggaacatactatgaaacggcacctcatttgagttcggagccgtcaaatattgat
catgggattattccaagagacgaaaaagatgagtacgtaactgtggatgctgttacggag
aaagtagtaactgccgctatagatgatggagatgatttggtatatcgacaaaggcttaat
gcttggtgtgcgaatcgtaaggaattacgagatcaggcctcagcatctgaaaacaataaa
gatagaggagagtttgaaggtaaagatgagtggttactacctcatccttccaaaaaagga
cagacttttgagggtggatttaccatcccaggtgatattcgcccacatcttttccgttat
caagtcacttgcgtacaatggttatgggaactctattgtcaagaggccggaggaatcatt
ggtgatgaaatgggactaggaaaaactattcaaatagtatctttcctttcgtctttgcat
cactctggcaaatttcaaaagcctgcacttatcgtttgtccagcgactttaatgaagcag
tgggttaatgagtttcatacatggtgggctccattacgtgttgttgttcttcatgctact
ggcagcggacagcgtgcttcacgcgaaaagagacagtatgaatctgacgcttctgaaagt
gaagcggaagaaagcaaaacctccataaaattaagaggtgcttcaagttcattccacaga
tacgctaagaacttagttgaaagtgtcttcactagaggccacattttaattacaacatat
gctggtttaaggatatatggtgatttgattttaccacgggaatggggttattgtgttttg
gatgaagggcacaaaatacgaaacccagattctgaaatatctatttcgtgtaagcaaatc
cgtactgtgaataggattatcctctcagggactccgatccagaacaaccttaccgagctt
tggaatttatttgattttgtatttcctggaagattgggtacattaccggtatttcaaaat
caatttgccttacctattaatattggtggttatgccaatgcttcaaatgttcaagtgcaa
accgcttataaatgcgcctgcatgcttcgagatttaatttctccttatttacttagaaga
atgaagcttgacgttgctgcagatttacctaagaagtccgaacaagtattgttctgtaag
ctgactcctttacaaaggaaagcttaccaagattttttgcaaggctctgatatgcaaaag
atcttgaacggaaagcgtcaaatgctttatggaattgatatactacgaaaaatttgtaat
catccagatcttgtaactcgagagtacttgttacataaagaagattacaactatggtgat
cctgaaaagtctggcaaactgaaggttattagagcattactaactttgtggaaaaaacaa
ggacatagaactcttctattttctcagactcgccaaatgctcgacatactggaaatagga
ttaaaggatttgccggatgttcattactgtcgcatggatggtagcacatctattgcttta
agacaagatttggtggacaactttaataaaaatgagtattttgatgtgtttcttctaact
actcgtgttggtggattaggagtcaatttgactggtgctgacagggtaattctttttgat
cctgattggaatccctcaacggatgctcaagcacgtgaacgtgcttggagactgggccaa
aagaaagatgtagtagtttatcggttgatgactgctggaactattgaagaaaaaatttat
catcgtcaaatctttaagcagtttctgactaacaaaattttgaaagatccaaaacaaaga
aggttttttaaaatgacggacttgcacgatttgtttacgttaggcgataacaagactgag
ggcactgagacaggcagcatgtttttgggatctgaacgagtacttcgaaaggataattcc
tcaagaaatggcaatgaagctgaagatattccagctcgtgaccgaaaaaagcacaaaatt
cacgacaaaggtaaaaaagttaacagctccaaagtgtttgaaaaaatggggattgcatcg
atggaaaagtataaaccaccgcaagagtcaaatgttactaagacaaactctgattcgact
ttaggggatgattccgtccttgatgatatttttgctagtgctggtattcagagtacttta
aagcacgacgatatcatggaagcctcccagactgaaagcatattggttgaaaaagaagcg
acgcgtgttgctaatgaagctctgcgtgcagtttcatcttttcggcgacctcctcgtcaa
cttatacctccgcagcaatctactaatgttcctggtacttctaaaccatcaggtccgatt
acttcaagcactcttcttgcccgactaaaacagagacgatga

DBGET integrated database retrieval system