KEGG   Schizosaccharomyces pombe (fission yeast): SPCP31B10.04
Entry
SPCP31B10.04      CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Psg1 Adeno_PIX FixQ
Other DBs
NCBI-GeneID: 2539450
NCBI-ProteinID: NP_587860
PomBase: SPCP31B10.04
UniProt: Q9USH0
Position
III:join(527602..527665,527751..528092,528190..528647)
AA seq 287 aa
MKVICGSVFLFSLFFQVVLGDYFSSSSGNPNLRTTKVYTVVSGTHLATAESTVSKTITTT
KGLPTNAYYNCVPSKYIQSDIPMCAPNQGDRWVKGRKYKVSWDPLYFGVDNLLMVVSYLN
DSGLIAATKKVQNSKGEIMLKANKGWLHDDSFQNVTIDLVTISENNMTLLTGPRILLAKD
LDSATAAAENAAFYGPRRNIKAAIAVPSVILGLILVALVYYAYRKDTWKIYMAKIRIRRS
APGYGVRRSRRQRMQSRPVAYTSLPADAHFEDSDDEDYYQSQVKKFH
NT seq 864 nt   +upstreamnt  +downstreamnt
atgaaagttatttgtggatcagtgtttctgttttcacttttctttcaagtagttttagga
gattatttttcctcgtcttccggtaatcctaacttgaggactacgaaagtgtatactgta
gtcagtggaactcacctggctacggctgaaagcactgttagtaaaacaatcaccacgaca
aaaggtttaccgactaatgcttattacaactgtgttccttctaaatatatccagtcggat
atacccatgtgtgcacctaaccaaggggatcgttgggtaaaaggtcgcaagtataaagtg
tcatgggatcctctgtactttggagttgataatcttcttatggtagtttcctatttaaac
gatagcgggttgattgccgctaccaagaaggttcaaaattcaaaaggagaaataatgtta
aaggctaacaaaggttggcttcatgatgatagtttccagaatgtcaccatcgatttggtt
actattagtgaaaacaatatgacgctgcttaccggaccaagaatcttacttgccaaggat
ttagatagtgccaccgctgccgctgagaatgcagctttctatggtccaaggagaaatatc
aaggcagccatcgccgtcccgtctgtaattttggggcttattctcgttgctctcgtatac
tacgcttataggaaggacacttggaaaatttatatggcaaagatcagaatccgtagatcc
gctcctggatatggtgtgcgacgcagcaggcgccaacgtatgcaaagccgtcctgttgcc
tatactagtcttccagccgatgcacactttgaggactcggatgatgaggattattaccaa
tcacaagtaaaaaaattccattaa

DBGET integrated database retrieval system