KEGG   Schizosaccharomyces pombe (fission yeast): SPCP31B10.06
Entry
SPCP31B10.06      CDS       T00076                                 

Gene name
mug190
Definition
(RefSeq) C2 domain protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: C2 MPP6
Other DBs
NCBI-GeneID: 2539477
NCBI-ProteinID: NP_587862
PomBase: SPCP31B10.06
UniProt: Q9USG8
Position
III:533322..536888
AA seq 1188 aa
MSTHSGDSTKQQHYRSSDPYSGRRPIPTIPKFFRDRKQRAEKKEEQQREQTENEKLFDPI
TQRDVEINDVHFDYAKTYDDPSFTVPNQSIQGSSLPSEKPYLSSNQPTNVYKQHQDDLAP
PEADNQITRDVPISDEKTNILFFPSPSIDLSYVSKEVKQKTGQYSLFAYIFSLVISWFFT
HSIIISAVLPLAISSCMYLWMQNIYAVAKDAEWGAEQKRGEYARLNLIPESAEWMNHLLE
KVWPLINPEMFSSVADQIEDVMQASIPSFVENVRVASLDQGSHPVRVVSIRSLPSGEASE
SFSEKQASEAEHKDEPEQQRKQFYNFELCLAYHAKPVEDATSTSARASNLHLRIVFYPGI
KGTVGFPLPIWVEIKGFVARIRFRCELMPEVPFLKNVTFSLMGLPELNVSAVPVAEGGVN
IFGLPLISKFVNDAISAAANEYVSPKSMTIDLSKTLLGDDIKKEVNALGVIFVHINRAED
LSKQDVNGLSDAYITVGFHKFGKPLYCTRVVKQDLNPIWNEYAFIPVFPDQVKAGEKISI
ELWDSDRFSPDDVVGRTKIGLHLLIQDSGKMHERCDTLTGISEDTSLPGRVFYEIGYFPR
AEFKPSLKTSGHDITIPRSMRDDPAFQNPHGSLDNKEEEAAVTTAPDEEYPSGILSFTVH
QAVNLQMNHPTGTFGNVSGNYNTSPAQSVGDVTAEEGSELPSSYVCVDLDDTLVYKTRTK
VFTSNPIYNAGSEKFVKDWRNAMLCFTVRDFKLREHDSILGVVNIPLATTLTTSSQLTKW
YPIQGGIGFGSVRISILFRSMKLKIPRNLLGWDIGTLEFMDRQIVAEGTGSVSDVSFSSI
RVNIAGVKITAKSSTSNSSSTAEYHVRSRHAVIPVNNRYRSAVVFEFRKQLQRKHNVFAM
VWLVDLEDNVEQNIRVPIFTSSKPAHVLQNMIDFDHPDKESEFKIIGYLSTRICFHRGLD
DSHEQLVDNDDEAAIFETYRCLKSMGLRRGYVKDMKNPLADQRASLDESRETTTASSKFE
SDDSVDTEDEETTTDRTPIECTQTVSMVDPNVNGDIQGRNSLGTMNSNERNLEQEFISLG
YASKNRPKAHAQEGTNQPGASENVEPVLADDSDAVTIHSNISSDDQKRKLVNADDRELEK
RLHRGPYNSKIVRTGEWVKDGAKMGWRNLRRKFALNGRQPDVETEISK
NT seq 3567 nt   +upstreamnt  +downstreamnt
atgtctactcatagcggagattccaccaagcaacaacactatcgctcttctgacccctat
tcaggacgtcgtccgatccccactattccaaaattctttcgcgatcgcaaacagcgtgca
gagaaaaaggaagagcaacaacgggaacagactgaaaacgaaaaattattcgacccaatt
acccagcgagatgtagagattaacgacgttcatttcgattatgccaaaacatatgatgat
cctagttttacagttcctaatcaatcaatccaaggttcatccttaccttctgaaaagcct
tatttgtcatccaaccaaccaacaaatgtttataagcagcatcaagatgatttagctcca
ccagaagcggataatcaaatcactcgtgatgtccctattagcgatgaaaaaacgaatatt
ctctttttcccctccccttccattgatctatcttatgtatcgaaagaggtcaaacaaaaa
actggtcaatattctttgtttgcatatatattttctctcgtaatttcgtggttctttact
cattctattatcatttcagccgtgttgcctctggccatttcttcatgtatgtatttatgg
atgcaaaatatatatgctgttgccaaggatgcggaatggggcgctgaacaaaaacgcgga
gaatacgctcgtttgaatttgattcccgaaagcgccgagtggatgaatcatttattggaa
aaagtttggcccttaatcaatcctgaaatgttttcttctgtagctgaccaaattgaagat
gtaatgcaagcctctataccgtcgtttgttgaaaatgtgcgcgttgcttctttggaccaa
ggaagtcatcccgttcgtgttgtttccattcgaagtttgccttcaggtgaggccagtgaa
tcgtttagtgagaagcaagcctctgaagctgaacacaaagacgagccagaacagcagcga
aaacaattttataacttcgaactttgtctagcttatcacgccaaacccgttgaggatgca
acatcaaccagtgctcgagcttccaacctgcatttacgcatagttttttatccaggtatt
aaaggtacagtgggatttccccttccaatatgggtcgagataaaaggatttgttgctaga
atccgctttcgctgtgaactcatgcctgaggttccttttttgaaaaatgtcaccttctct
ttgatgggacttcccgaactgaatgtgtccgctgttcccgtagctgagggaggtgttaac
atatttggacttccattaatttcaaaattcgttaatgacgctatttccgcggctgcaaat
gaatacgttagtcccaaaagtatgactattgatttgtccaagacgcttttaggagatgat
ataaagaaagaggtcaatgcattgggcgttatttttgttcatattaatcgtgcagaagat
ttaagtaagcaggatgtgaatggtctttctgatgcttatataaccgtcggttttcataag
tttggtaaacctttgtactgtacacgcgtcgtaaaacaggatctgaatcctatctggaat
gaatatgcttttattcctgtgttccctgatcaagttaaagccggtgagaagatttctatt
gaattatgggatagtgacaggtttagtcccgatgatgtagtaggccgcacgaaaatcggt
ttacaccttcttattcaagattctggaaaaatgcatgaaagatgcgacacgcttactgga
attagtgaagatactagtctacctggcagggtgttttacgaaattgggtacttccctaga
gccgaatttaaaccttctttaaaaacgagtggacatgatatcactattccaaggtctatg
agagatgatccagcttttcaaaatccacatggctcattggataataaagaagaggaagct
gctgtcacgactgctcctgatgaagagtatcctagtggcattttatcttttaccgtgcat
caagctgtgaatttgcaaatgaaccatccaactggtacttttggaaacgtgagtggaaac
tataacacaagtccggctcagagcgtaggagatgtaacagctgaagaaggttcagagcta
ccttcttcctatgtttgtgttgatttagatgacacactcgtgtataaaacacgaaccaag
gtatttacatcaaaccctatttacaacgctggaagcgaaaaatttgttaaggattggaga
aatgcaatgttgtgcttcaccgtacgtgatttcaaattgcgtgaacatgattccattctt
ggagtcgttaacattccactcgctacgacgttaacaacttcttcccaactgacaaaatgg
tatcccatacaaggtggtatcggatttgggagtgttcgcatttccattctttttaggagt
atgaaattgaaaattcccagaaatttgttgggttgggatattggtactctggaattcatg
gatcgacaaattgttgctgaaggaacaggaagtgtatctgatgtttcattctcttcaatt
agagttaacatagcaggcgtaaaaattactgctaaaagtagtacttccaattcttccagc
actgctgaataccatgttcggagtagacatgctgtaattccagttaacaatcgttacaga
tcagctgttgtgttcgagttcagaaaacaacttcagaggaaacataatgtatttgccatg
gtttggttggttgatctggaagacaatgtagagcaaaacattcgggtcccgatttttact
tcgtccaaaccagcacatgttttacaaaacatgatagattttgatcacccggataaagag
tcagaatttaaaatcattggatatttgagtactaggatatgttttcatcgaggtttggac
gattcccacgagcaacttgttgacaacgacgatgaagcagctatatttgagacatataga
tgccttaagtcaatgggtttaagaagaggttacgtgaaagacatgaagaatccgttagcg
gatcaacgagcaagcctggatgaaagccgagagactaccactgcatcttctaaatttgag
tcagatgattctgttgataccgaggacgaggagacgaccacggatcggacaccaattgag
tgtacacaaacagtttcaatggtggatccaaatgtcaatggagatatccagggtagaaac
tctctaggtacgatgaatagtaatgaacgtaaccttgagcaagaatttatttctcttggt
tatgcctcaaaaaaccgaccgaaagcacacgctcaagaaggtactaatcaacccggcgct
tctgagaacgttgaacctgtattagcagatgatagcgatgctgttacaatacatagcaat
atttccagtgatgatcaaaaaaggaaattggtgaatgctgatgatcgtgaattggagaag
cgattacatcgtggaccttacaactcaaaaattgtgcgcacaggagaatgggtaaaagat
ggagcgaagatgggatggagaaatcttcgaagaaaatttgctttgaacggacgacagcca
gatgttgaaaccgagatttcaaaataa

DBGET integrated database retrieval system