KEGG   Schizosaccharomyces pombe (fission yeast): SPCPB1C11.02Help
Entry
SPCPB1C11.02      CDS       T00076                                 

Definition
(RefSeq) amino-acid permease
  KO
K03293  amino acid transporter, AAT family
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SPCPB1C11.02
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-GeneID: 2539031
NCBI-ProteinID: NP_588425
PomBase: SPCPB1C11.02
UniProt: Q9C0V0
Position
III:2072967..2074484
Genome map
AA seq 505 aa AA seqDB search
MDASVSLLPEGESLHRSLSASQIQMLAFGGIIGTGLFLGIGSSLAESGPASLLISFSVLG
VSVYCTMLALGEMSVYMPVAGSFCTYVGRYVDEALSFSLTWNYWLNDTIALASHVLATRL
VVDFWLIPTEGDPVSASLSLPPWKEAVRIITPITSLSANIILNMLPVGGFGEIEYWLSSI
KVFTVAAFIVNGILCNLGVNNEKKFIGFRYWKDPGAFNNGIIGVISSFVNAAFAYAGTES
IALTAGEAKSPITTLPKAIRFTAHRVLLLYIISVLVVGINLPYNTPGLDGDSVRMSPFTF
VFKKFGVPGAASIMNLVILSSALSAGNHSLYAGTRLLYSLAKSGHAPKVFSKCNKHGIPW
LSVLATSATAILCLMSSQAGKTWGFLLNVIAVSNQISWIFIAVSSLRFRKALRVQGKTHR
LYFPNWTYPVGPYIIILLNGVFLFLQGYKSLYPFRLSLFVSYYMEIPIVLGLYLIWKIYK
KTKLVSSSEADLETDWKSLEDTDSA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaagtgtaagtctccttccagaaggagaatctcttcatcgctctttatcggcc
agccagattcaaatgttagcatttgggggcattattggaactggtctttttttaggaatt
ggctctagtttggcggaatcgggtcctgcttccctactgatttcattctctgtacttggt
gtaagcgtttattgtaccatgctagcgcttggcgaaatgtccgtctatatgccagtggct
ggctctttttgtacatatgtaggccgatatgtagatgaggccctgagcttttcccttact
tggaattactggctgaatgatacgattgctttagcaagccatgttttagcaactcgattg
gtagttgatttttggttaatacctactgagggtgatcctgtaagtgcatctctctccttg
cctccttggaaagaggccgtccgaatcattacgccgatcacttcgttgtctgcaaatatc
attcttaatatgcttcccgttggcggttttggcgagatcgagtactggctttccagcatc
aaggtattcacggtggctgcatttattgttaatggcattttatgcaacctcggagttaac
aatgagaaaaaattcattggatttcgctattggaaagatccaggagccttcaataatggt
attattggtgtcataagtagtttcgtcaatgctgcttttgcctatgctggcactgagtca
atcgctctcaccgctggtgaagccaagtctccaattaccacattacccaaagcaattcgc
tttacagcacatcgtgttttgttgctctatataattagtgtcttggttgttggtattaat
ctgccttataatactcccggtctcgacggcgactctgtacgcatgtccccgttcactttt
gttttcaaaaaattcggcgttcccggtgcggcgagtataatgaatttggttatattgtca
tcagcattatcagcaggaaaccactctttatacgctggaactcgtctgctgtattccttg
gccaaatctggtcatgcgcctaaagtgttttccaaatgtaacaagcatggaattccttgg
ctgtcagtgcttgctaccagtgcaactgcaattttgtgtctcatgtcttcacaagctgga
aagacatggggctttttactaaacgtcattgccgtctccaaccagatttcatggatattc
attgccgtttcaagtttacgatttcgcaaagctttacgagttcagggaaaaacccataga
ctgtattttcccaactggacctatcccgtaggcccttatattattatcttattaaatggc
gtatttcttttcctacaaggctacaagagtctctatccttttcgtctttcgcttttcgtt
agttattacatggagatacccattgtgcttggattatatctaatttggaagatttataag
aagaccaaattggtcagttcaagtgaagctgatttggaaacagattggaaatccttagag
gacactgactctgcatga

DBGET integrated database retrieval system