KEGG   Schizosaccharomyces pombe (fission yeast): ScpofMp09
Entry
ScpofMp09         CDS       T00076                                 
Name
(RefSeq) ATPase 9
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00190  Oxidative phosphorylation
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ScpofMp09
SSDB
Motif
Pfam: ATP-synt_C DUF5714
Other DBs
NCBI-GeneID: 1669532
NCBI-ProteinID: NP_039507
UniProt: P21537 A0A516IKT9
Position
MT:17806..18030
AA seq 74 aa
MIQAAKYIGAGLATIGVSGAGVGIGLIFSNLISGTSRNPSVRPHLFSMAILGFALTEATG
LFCLMLAFLIIYAA
NT seq 225 nt   +upstreamnt  +downstreamnt
atgatacaagctgcaaaatacattggtgctggtttagctacaattggtgttagtggtgct
ggtgttggtattggattaatcttcagtaacttaatctcaggtacttcaagaaacccatca
gttcgacctcacttattctcaatggctatcctaggattcgccttaacagaagctacaggt
ttattctgtttaatgttagcgttcttaattatctacgctgcttaa

DBGET integrated database retrieval system