KEGG   Sporanaerobacter sp. NJN-17: EQM13_09055Help
Entry
EQM13_09055       CDS       T05805                                 

Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
spoa  Sporanaerobacter sp. NJN-17
Pathway
spoa00620  Pyruvate metabolism
spoa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EQM13_09055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spoa02000]
    EQM13_09055
Enzymes [BR:spoa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EQM13_09055
Transporters [BR:spoa02000]
 Other transporters
  Primary active transporters [TC:3]
   EQM13_09055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like DUF561 DUF3137 ENT Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: QAT61725
UniProt: A0A410QCK9
Position
complement(1880476..1881873)
Genome map
AA seq 465 aa AA seqDB search
MKKIKITETAFRDAHQSLLATRMRTDEMLPIADKMDRVGYYAMEVWGGATFDSCLRFLNE
DPWDRLRKLRKAFKNTKLQMLLRGQNLLGYKNYPDDIVEEFVKKSIENGIDIIRMFDALN
DMRNIQKTLEATKKYGGHAQIAISYTVSPVHNIEYYVQLAKEMENMGADSICIKDMSGIL
LPYVAEELIKKLKKVIKIPIEIHSHFTSGIANQTYMKAIEAGADIIDTAISPLGMGASQP
ATESMVSSLKYSPYDPDLDMDLLMEIAEYFKGLKDKYIKEGLLKPKIFDIDARTLKYQVP
GGMLSNLLSQLEYQGASDKFEDVLEEIPKVREDLGYPPLVTPMSQMVGTQALSNVLMGER
YKLVSKEIKNYVKGLYGKPTVPIREDIKKKIIGDEEVYTGRPADLLKPQLEQCKNEIKEY
MEQDEDVLSYALFPQVALNYFKYRQAKKYKIDCSLTNEEYKVYPI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataaaaattaccgaaacagcctttagagatgcacaccaatctttattggca
acaagaatgagaactgatgaaatgcttcctatagctgataaaatggacagagttggatat
tatgccatggaagtatggggaggagctacttttgattcctgcctaaggtttttgaatgaa
gatccttgggataggctcagaaaattaagaaaagcttttaagaatactaagcttcagatg
ctactaagaggacaaaatttattaggatataaaaattatcctgacgatattgttgaggag
tttgtaaaaaaatctatagaaaacggaatagacataataaggatgtttgacgcattaaat
gatatgagaaatattcagaaaactcttgaagcaacaaaaaaatacggcggtcatgctcaa
attgctatttcctatactgtaagccccgtacacaatatcgaatattatgtacaactggca
aaagagatggagaatatgggtgccgattctatctgcattaaggatatgtcgggaatactt
cttccctatgtggctgaagaattaataaaaaaacttaaaaaagtaataaagattcctata
gaaattcattcccattttacaagcggaattgcaaaccaaacatatatgaaggccatagaa
gcaggagcagatataatagatacagctatttctcctttgggaatgggagcaagtcagccg
gcgacagaatccatggtatcttctttaaaatattctccttacgatccggatttagatatg
gatttacttatggaaattgcggaatatttcaaaggattaaaggataaatatattaaggaa
ggtttattaaagcctaaaatttttgatatcgatgcaaggacattgaaatatcaggttccg
ggaggaatgctgtcaaatttattatctcagcttgaatatcagggagcttcggataaattt
gaagatgtattggaagagatacctaaagtaagagaagatttaggatatcctccgttggtt
accccaatgagtcagatggtaggaactcaagctctttctaatgtattgatgggtgaaaga
tataaacttgtttcaaaggagataaaaaactatgtaaagggtttatatggaaaacctact
gtccctattagggaagatataaagaaaaaaataataggagatgaagaagtatatacaggc
aggcctgcagaccttttaaagcctcagcttgaacaatgtaaaaatgaaattaaggaatat
atggaacaggatgaagatgtcctttcctatgcattatttcctcaggtagcattaaattat
tttaaatacaggcaagcaaaaaaatataaaatagattgttctttgacaaatgaagaatat
aaagtttatcccatataa

DBGET integrated database retrieval system