KEGG   Tissierellia sp. JN-28: EQM13_10945
Entry
EQM13_10945       CDS       T05805                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
spoa  Tissierellia sp. JN-28
Pathway
spoa00472  D-Arginine and D-ornithine metabolism
spoa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spoa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    EQM13_10945
Enzymes [BR:spoa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     EQM13_10945
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: QAT62066
UniProt: A0A410QDK7
Position
complement(2278888..2281104)
AA seq 738 aa
MELKPNEKLSIENILKDLDKYRPRRRGWTWRKGTGQKRKIWQFEYHDTSENLKQSQPLPA
SKYFDNIDPQPEPVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHIDGLIEGT
PQGIGGIPVTRKQVRAQRKALDLIEDEVGRPINYHSYVSGVAGPEVAVMFAEEGVNGAHQ
DPQYNVLYRDINMIRSFVDAASAKKVMAWADMAQIDGAHNANATAREAWKVMPELMVQHA
LNSIFSVKVGMKKGNICLSTVPPTAPPAPCMRLDLPYAVALREFFTGYRMRAQMNTKYME
SSTREATVTHVLNLMISKLTSADIQSTITPDEGRNVPWHIYNIEAVDTAKQALVGMDGLE
EMVEIKRDKGELADRVREIKERAVLFMEEILEVGGYFKAVQDGFFVDSGYYPERNGDGIA
RQIDGGVAAGTIVERDKDYMTPVTAVFGYNNVAQYDKTAVDNPSKLIGGCTFEDPDKIVY
IDELDETDNVNVRMEENKELRNSTKIKPEMEWLGDGTILITMFLPAEARTAEFAAIEIGK
KLGLENVEAISREIMQEAEGTRVEIKGKVPFTIDTSKLVIPPKPEVMTDDEIREEIDAHP
MKIVAATVGEDEHSVGLREIIDIKHGGIEQYGIKCVYLGTSVPVEKLVDAAIEEKADAIL
ASTIISHDNVHYKNMKKIHELCVEKGIRDKVIIATGGTQVSNELAVKTGVDVGFGRGSKG
SEVATFLVKKRREMREKK
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggagcttaaacctaatgaaaaattgagcattgagaatattttaaaggacctcgataaa
tacaggccgagaagaagaggctggacgtggagaaagggaacaggacaaaagagaaaaata
tggcaatttgaataccacgatacatcagaaaatttaaagcagtctcagccgttgcctgcc
tcaaaatattttgataatattgatcctcagcctgaaccggttataaccacggaaattgct
tcgggaaggtttgaagatgatatcagaagaatgagaatggccgcatggcatggagcagat
catataatggttataagaacagcgggccaaagccatattgacggattgatagaagggact
cctcaaggtataggaggaataccggtaaccaggaaacaggttcgtgctcagagaaaagca
ttggatttaatagaagatgaagtgggccgcccgataaattatcactcttatgtaagcggt
gtggcaggcccggaggttgcggtaatgtttgcggaagaaggcgtaaacggggcccatcag
gatcctcagtataacgtgttatacagggatataaatatgataaggtcctttgttgatgcc
gcttctgcaaagaaggttatggcatgggcagatatggctcagatagatggtgcccataat
gccaatgcaacagcaagagaagcatggaaggtaatgccggaacttatggtacagcatgcg
ctgaacagtattttttcagtaaaagtcggaatgaagaaggggaatatttgcctttcgaca
gtaccgcctacggcaccgccagctccttgtatgagattggacttaccttatgccgtagct
ctgagagaattttttacgggatacagaatgcgtgcccagatgaataccaagtatatggaa
tcttcaacaagagaagctacagttactcacgttttaaaccttatgatttcaaaacttaca
agtgctgatattcagtcaactattacacctgatgaaggaagaaacgttccatggcatatt
tacaatattgaggcagtagatactgctaaacaagcccttgtaggcatggacggcctcgag
gaaatggttgagataaagagagataaaggagaacttgcagacagggtaagagaaataaag
gaaagagcagttcttttcatggaagaaatattggaagtaggaggatatttcaaggctgtt
caagatggcttctttgtggactcgggatattatcctgaaagaaacggagacggaatagca
agacagattgacggaggagttgcagcaggtacaatcgttgaaagagataaagattatatg
actcctgtaacagcggtattcggatataataacgtagctcaatacgacaaaaccgctgtg
gataatccttccaagttaatcggaggatgtacttttgaggatccggacaagatagtatat
attgacgaactggacgaaaccgataatgttaatgtaagaatggaagaaaataaagaatta
agaaattccacaaaaataaaaccggaaatggaatggctgggagacgggacaatcctaata
acaatgttcttgccggcagaagcaagaacggcagaatttgccgcaattgagataggaaag
aaattagggcttgaaaatgttgaagcaatcagtagggaaataatgcaggaagcagaagga
acgagagtagaaattaaaggaaaagttcctttcaccattgatacaagtaagttggttatt
ccgcctaaaccagaagtaatgacagacgacgaaatcagagaggaaatagatgctcatcct
atgaaaattgtagctgctactgtgggagaagatgaacattctgttggtttgagggaaatt
atcgatatcaaacacggaggaattgaacaatacggtattaagtgtgtataccttggaaca
agcgtgcccgttgagaagctggtagatgccgctatagaagagaaagcggatgccatcctc
gcttcaactattataagccatgacaatgttcactacaagaatatgaagaaaatacatgaa
ctttgtgttgaaaaaggtataagagataaagtaataattgctaccggaggaactcaggta
tctaatgaactggcggttaaaaccggcgttgatgtaggtttcggcagaggatcaaaaggc
tctgaagtagctacattcttggttaaaaaaagaagagaaatgagagagaaaaaatga

DBGET integrated database retrieval system