KEGG   Sporanaerobacter sp. NJN-17: EQM13_14380Help
Entry
EQM13_14380       CDS       T05805                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
spoa  Sporanaerobacter sp. NJN-17
Pathway
spoa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spoa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EQM13_14380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spoa03011]
    EQM13_14380
Ribosome [BR:spoa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EQM13_14380
  Bacteria
    EQM13_14380
  Archaea
    EQM13_14380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QAT62668
UniProt: A0A410QFQ3
Position
complement(2979816..2980151)
Genome map
AA seq 111 aa AA seqDB search
MEAKAIAKYVRISPLKVNFICKEIRGKQVDEALAILRYTPKRGAKVLKKVLTSAVANAEN
NFNLDRENLYVAEAYANDGPTLKRWRPRAKGMAYPILKRSSHIGVTVKEKE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaggctatagctaaatatgtgcgaatatcgcctttaaaggttaattttata
tgtaaagaaattagggggaagcaagtagatgaagctcttgctattctcagatatactcct
aaaagaggcgctaaagtattaaaaaaggttttaacatctgctgttgctaatgctgaaaat
aattttaatttagatagagaaaatctttatgtagcagaggcttatgcaaatgatgggcct
actttaaaaagatggagaccgagagctaagggaatggcatatcctattttaaagaggagc
agtcacataggtgtaacggtaaaagaaaaagaatag

DBGET integrated database retrieval system