KEGG   Spongiibacter sp. IMCC21906: IMCC21906_00683Help
Entry
IMCC21906_00683   CDS       T03945                                 

Definition
(GenBank) Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB
  KO
K04112  benzoyl-CoA reductase subunit C [EC:1.3.7.8]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi00362  Benzoate degradation
spoi01100  Metabolic pathways
spoi01120  Microbial metabolism in diverse environments
spoi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IMCC21906_00683
Enzymes [BR:spoi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.8  benzoyl-CoA reductase
     IMCC21906_00683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGD-D
Motif
Other DBs
NCBI-ProteinID: AKH68376
UniProt: A0A0F7M0B5
Position
complement(733073..734254)
Genome map
AA seq 393 aa AA seqDB search
MSKHSADALLILENIANHPDAYLAEWKAKHQKPIIGIFPMNFPVEIIAATGALPVIIQDS
REPISEGNTILAEFYCGYTRSIADQAMKGQLDIFDAFMNADHCIQLLGSVDVVREMLSDK
PVYFEHLIAAMDDSWTKVQVQEKIDAFIAEAERVTGQAISNEALARCIKSNNRNRQLLRQ
VFEARRNGDAQFTPAELQTMIVSSMIMDKDEHTALLETILADAASKPRDNRIRLHLSGHF
CHAPRVELFDLLEDCGAVIVDDDLYTGARYISTDINESQDPRIAMADWYFARNENIPCPT
RVQKSVNWDSYLLNVLNNNGAEGVIVLMAKFCEAHMFYYPELRKALNSQNIPHLLIETEH
EGMPVETIRTRVEAMIERIRRKSPSRQTTQESA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcacagcgccgatgcgcttctaattctggaaaatatcgcaaaccaccccgac
gcctatctcgccgagtggaaagccaaacaccaaaagcccattattggcattttcccaatg
aatttccccgtggaaatcattgccgccacgggcgccctacctgtcattatccaagatagc
cgagagcccatctcagaaggcaacaccattcttgccgagttctattgtggctacacccgc
agcattgcggatcaagccatgaagggccagctggatatttttgacgcctttatgaatgcc
gatcactgcattcagttattggggtcagtggacgtggttcgagaaatgctgtctgacaag
ccggtttattttgaacacctgatagcggccatggacgattcctggaccaaggttcaggtg
caggaaaaaatcgacgcatttatagccgaagccgaacgtgtcacaggccaagccattagc
aatgaagctctggcgcgctgcatcaagtccaacaacagaaaccggcagctgctaagacag
gtttttgaggcacgccgcaacggcgacgctcaattcacccccgcagaactgcaaaccatg
attgtctccagcatgattatggacaaagacgaacataccgccctgctagaaaccattttg
gctgatgccgccagcaaaccccgagataatcgcattcgcctgcatctgtctggccatttc
tgccacgcgccccgagtggaactgtttgatttactcgaagactgcggcgcggttattgtc
gatgacgacctgtacaccggcgcccgctacatctctaccgatatcaacgaatcacaagac
cccagaatcgcaatggcagactggtactttgccagaaacgaaaatattccctgcccgacc
cgcgtgcaaaaatccgtgaactgggacagttacctgctcaacgttttgaacaacaacggc
gccgagggcgttattgtgctaatggccaagttctgcgaagcccatatgttttattacccg
gagttacgcaaggccctaaacagccaaaacattccccacctactcatcgaaaccgaacac
gaaggcatgccggtggaaaccattcgcacccgggtcgaagcgatgatcgaacgaattcgt
cgtaaatcacccagccgccaaactactcaggagtcagcgtaa

DBGET integrated database retrieval system