KEGG   Spongiibacter sp. IMCC21906: IMCC21906_00921Help
Entry
IMCC21906_00921   CDS       T03945                                 

Definition
(GenBank) ribosomal protein L22, bacterial type
  KO
K02890  large subunit ribosomal protein L22
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    IMCC21906_00921
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spoi03011]
    IMCC21906_00921
Ribosome [BR:spoi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    IMCC21906_00921
  Bacteria
    IMCC21906_00921
  Archaea
    IMCC21906_00921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TetR_C_22
Motif
Other DBs
NCBI-ProteinID: AKH68601
UniProt: A0A0F7M0Y6
Position
974373..974711
Genome map
AA seq 112 aa AA seqDB search
MEVAARLKGARISAQKARLVADQIRGKGVEEALDTLSFSSKKAASIIKKVLNSAIANAEH
NDGADVDELKVSTIFVDEGMTMKRLRPRAKGRADRILKRSCHITIKVADTEG
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagcggcacgtttaaaaggtgcaagaatctccgctcaaaaggcccgcctggtc
gctgaccagatccgtggcaagggtgtcgaggaagcgctggatacattgagtttcagctct
aaaaaagcagctagcattattaaaaaggtgctgaattctgcaattgcgaacgccgagcat
aatgatggtgcggacgttgatgagctgaaggtgtcgaccatttttgtggacgaaggtatg
accatgaaacgtctgcgcccccgtgcaaaagggcgtgcagatcggattcttaagcggtca
tgtcatatcaccattaaagttgccgacaccgaaggctag

DBGET integrated database retrieval system