KEGG   Spongiibacter sp. IMCC21906: IMCC21906_01379Help
Entry
IMCC21906_01379   CDS       T03945                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi00071  Fatty acid degradation
spoi00280  Valine, leucine and isoleucine degradation
spoi00310  Lysine degradation
spoi00362  Benzoate degradation
spoi00380  Tryptophan metabolism
spoi00620  Pyruvate metabolism
spoi00630  Glyoxylate and dicarboxylate metabolism
spoi00640  Propanoate metabolism
spoi00650  Butanoate metabolism
spoi00900  Terpenoid backbone biosynthesis
spoi01100  Metabolic pathways
spoi01110  Biosynthesis of secondary metabolites
spoi01120  Microbial metabolism in diverse environments
spoi01130  Biosynthesis of antibiotics
spoi01200  Carbon metabolism
spoi01212  Fatty acid metabolism
spoi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC21906_01379
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC21906_01379
   00640 Propanoate metabolism
    IMCC21906_01379
   00650 Butanoate metabolism
    IMCC21906_01379
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IMCC21906_01379
   00072 Synthesis and degradation of ketone bodies
    IMCC21906_01379
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IMCC21906_01379
   00310 Lysine degradation
    IMCC21906_01379
   00380 Tryptophan metabolism
    IMCC21906_01379
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IMCC21906_01379
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IMCC21906_01379
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IMCC21906_01379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spoi04147]
    IMCC21906_01379
Enzymes [BR:spoi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IMCC21906_01379
Exosome [BR:spoi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IMCC21906_01379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKH69057
UniProt: A0A0F7M470
Position
complement(1479719..1480951)
Genome map
AA seq 410 aa AA seqDB search
MATTYDDAWLIDGRRTGFGSLNGSLSQLSATDLGIAAVKGLLATGDYQADDFQCLFAANL
APSDFDAGYLPRHIGLYSGLPQTMPALMLQRLCGSGFELIASAADYRQLNKAEVMMCVGA
ESMSRMPMCNFTARGGFKLGQVDFRDYLMELLYDAAADIPMGCTAENLAKKYKLSREEVD
AFAYESFQRALAAKESGVLSDEILELTSQTFECENLKTRNFRLPRGVDSFNTDEHVRPTT
LETLAKLRPSFAKDGVQTGGNSSGIVDGAAAAIVASKAYADKKGIKPLAQIRASAAAAVD
PHIMGIGPVPAINDILEATGLSLSDIGLFEINEAFSAQCLAVAKDMGIDLEKLNVNGGAT
AYGHPLAATGVRCTTTLAKEMKRRGVRYGIASACVGGGQGSALLIENTEA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaacatatgatgacgcatggttaattgatgggcgtcgtaccggctttggctcc
ctcaatggcagcctttctcaactttccgccactgatctaggcatcgcggccgtgaaaggc
ttgctggccacgggtgattaccaagctgacgattttcaatgcctgtttgctgccaacttg
gcgccttccgattttgacgccggctacctgccccgccatatcggtctttattctggtctt
cctcaaacgatgcccgcactcatgctgcaacgcctttgtggttctggctttgagctgatt
gcttctgctgccgattaccgccagttaaacaaagccgaagtgatgatgtgtgtcggcgca
gagtccatgtcgcgtatgcctatgtgtaatttcacagcgcgcggcggctttaaactaggt
caggtcgatttccgcgactaccttatggaactcttatatgacgccgccgctgatattccc
atgggctgcacggcagaaaacctggctaaaaagtacaagcttagccgtgaagaagtcgat
gcctttgcctatgaaagcttccagcgtgcgctggcggcaaaagagtccggcgtactcagc
gatgaaattcttgagctgacctcacaaacctttgaatgcgaaaatttaaaaactcgcaac
ttccgtctgcctcgtggtgtcgatagctttaacaccgatgagcatgtacgccccactacg
ctggaaacactggcaaaactgcgtccctcttttgctaaagatggcgttcaaactgggggt
aacagctccggcatcgtagacggagctgcagccgctatcgtcgccagcaaagcctacgca
gataaaaaaggcattaagccattggcgcaaatcagagcctcggctgctgctgcagtagat
ccacacattatggggattggtccagttccagcgatcaatgatattttggaggccacaggc
ctaagcctaagcgatatcggcttatttgaaatcaatgaggctttctctgcacagtgttta
gccgttgccaaagatatgggcattgatttagaaaagctgaatgtcaacggcggtgcaacg
gcctacggccacccactggcagcaacaggggttcgctgcaccacaacactggccaaggaa
atgaagcgtcgtggcgttcgctacggtatcgcctccgcttgtgttggtggtggtcaaggt
tctgcattattgatcgagaacaccgaagcataa

DBGET integrated database retrieval system