KEGG   Spongiibacter sp. IMCC21906: IMCC21906_01427Help
Entry
IMCC21906_01427   CDS       T03945                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi00450  Selenocompound metabolism
spoi00970  Aminoacyl-tRNA biosynthesis
spoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    IMCC21906_01427
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IMCC21906_01427
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spoi01007]
    IMCC21906_01427
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spoi03016]
    IMCC21906_01427
Enzymes [BR:spoi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     IMCC21906_01427
Amino acid related enzymes [BR:spoi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   IMCC21906_01427
Transfer RNA biogenesis [BR:spoi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    IMCC21906_01427
 Prokaryotic type
   Other AARSs
    IMCC21906_01427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AKH69105
UniProt: A0A0F7M0X9
Position
complement(1536711..1538759)
Genome map
AA seq 682 aa AA seqDB search
MSRKILVTSALPYANGPLHLGHLLESIQTDIWVRYQKLRGNDCAYLCADDAHGTAIMLTA
EKLGITPEEQIARVKAEHERDLAGFLVQFDNYYSTHSPENRELSELIYNRLDANGHIERR
DITQLFDPERELFLADRYIKGSCPKCKAEDQYGDNCEACGATYTPAELINPRSAISGATP
IEKESTHYFFKLAEFTEMLRSWTRSDSLQPQIANKLNEWLDAGLHSWDISRDAPYFGFEI
PNAPGKYFYVWLDAPIGYMASCANWCAKTDRNFDDYWGKDSSAELYHFIGKDIINFHGLF
WPAMLDSAGFRQPTAIYAHGFLTVNGKKMSKSRGTFIKAETYLQHLPAEYLRYYFAAKLS
GAVDDIDLNLEDFTKRVNSDLVGKLVNIASRSAKFVHKGNDGKTSSALDNPALWEETIAL
SDTLAGYFENREYGKAVREIMSQADACNEYFDQREPWKLAKQEGGAAEAAAVASQCLNIF
RVLVTYLTPVLPELSKQAAAFLNCDIAWSGSFKPLLNHPITPFKAMISRVDPDKVAAMVD
ASAASTPAPNAQIENAKAPAKNATKKKEDSGIADTIEFPDFAKVDLRVAEIIAANAVEGA
DKLLQLTLSLGELGERNVFAGIKSAYQAEELVGKMTVMVANLSPRKMRFGVSEGMVLAAG
PGGGDIWLLSPDSGAKPGMKIQ
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggaagattctggtcaccagcgccctgccctatgccaacggcccccttcatttg
gggcacttgctggaatcgattcaaaccgatatctgggttcgctaccagaaattgcgtggc
aacgactgcgcttatctctgcgctgatgatgcccacggcaccgcgattatgctcaccgca
gaaaaactcggcatcactccagaagaacaaattgcccgggtcaaagccgaacacgagcgg
gacttggcgggctttttagttcagttcgataattattactccacccattcccctgaaaac
cgggaattatctgagctgatttataatcgcttagatgccaacggtcatatcgagcgccgg
gacattacccagctgtttgatcccgaacgggaattgtttctggccgaccgctacatcaaa
ggcagctgcccaaaatgtaaagccgaagatcagtacggcgataactgcgaagcctgtggt
gccacttacacccccgccgaactcatcaacccccggtcggcgatttccggcgctacgccc
atcgagaaagaatcgacccactactttttcaaactggccgaattcaccgagatgctccgc
agctggacccgcagcgacagcctgcagccgcaaattgccaacaaactcaatgaatggctc
gatgccggattacacagctgggatatttcccgagacgccccctattttggatttgaaatt
cccaacgctcccggcaaatatttttatgtttggctagacgcgcccatcggttacatggcc
agctgcgccaactggtgcgcaaaaaccgaccgcaactttgacgattactggggcaaagac
tccagcgccgagctctatcactttatcggtaaagacatcatcaatttccatggtctgttt
tggcccgcgatgctcgacagcgcaggtttccgccaacccaccgcgatttatgcccacggc
tttctcaccgtcaacggcaagaagatgtccaaatcacggggcacctttattaaggcagaa
acctacctccagcacctgcccgctgaatatctgcgctactactttgctgccaagctctct
ggcgccgtcgatgatatcgacctgaatcttgaagatttcaccaagcgcgtcaattccgac
ctggtgggcaagctggtgaatatcgccagtcgtagcgccaaatttgtccacaaaggcaat
gatggcaaaaccagttcggcattagataaccccgcgctatgggaagaaaccattgcactc
agcgacacccttgccggttattttgaaaaccgcgaatacggcaaagccgttcgggagatc
atgtcccaggccgatgcctgcaacgaatactttgatcagcgcgaaccctggaaactggcc
aagcaggaaggtggcgccgcagaagctgccgccgtagcctcacaatgtctgaatatattc
cgcgtattggtcacctacctgacacctgtgctgcccgaactcagcaaacaagcggcggcc
tttttgaattgcgatatcgcgtggtcgggcagtttcaaaccgctgctcaatcatcctatc
acgccatttaaagccatgatttcacgggtggatcccgataaagtggccgccatggttgac
gccagcgctgccagcacaccggcaccgaatgcccaaattgaaaatgcaaaagcgccagca
aaaaacgccaccaagaaaaaagaagacagcgggattgccgacaccattgagttcccggat
tttgccaaggttgatttacgcgtcgccgaaatcatcgccgccaatgccgtagagggcgca
gacaaactgctgcagctaaccctcagcttaggcgaactcggtgagcgcaatgtttttgcc
ggaataaaaagtgcgtaccaagccgaggagctagtgggtaagatgaccgtgatggtcgct
aacctatccccccgtaaaatgcgctttggtgtatctgaaggcatggttttagcggcaggc
cccggcggtggcgatatttggttgctcagccccgacagtggcgccaaacccggcatgaag
atccagtag

DBGET integrated database retrieval system