KEGG   Spongiibacter sp. IMCC21906: IMCC21906_01450Help
Entry
IMCC21906_01450   CDS       T03945                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
spoi  Spongiibacter sp. IMCC21906
Pathway
spoi00480  Glutathione metabolism
spoi00590  Arachidonic acid metabolism
spoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spoi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    IMCC21906_01450
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    IMCC21906_01450
Enzymes [BR:spoi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     IMCC21906_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: AKH69128
UniProt: A0A0F7M4F2
Position
1565726..1566208
Genome map
AA seq 160 aa AA seqDB search
MATVYDFKLNTLQGNELDFSAYQGKVVLVVNTASKCGFTPQYEGLQALHEKFKDQGLVVV
GAPCNQFANQEPGDASTIEGSCLINYGVSFPITEKVDVNGKNTHPLFAYLKESAPGTLGN
RVKWNFTKFLIGKDGKPIKRYAPTTKPQQMAGDIEAALNA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtttacgatttcaaattaaatactttgcagggcaatgaattagatttttct
gcctaccaaggcaaggttgttttagttgttaatacggcgagcaagtgcggctttaccccc
cagtacgaagggctgcaagctttgcatgaaaagtttaaagatcagggtttagtggttgtg
ggtgctccttgtaatcagtttgcgaatcaagagccgggggatgcttcgacgattgaggga
agctgcttaattaactatggcgttagttttcctattaccgaaaaggtggacgtaaacgga
aaaaatacgcacccgctattcgcttatttgaaagagagcgcaccgggcaccttgggtaat
cgcgttaaatggaatttcactaagtttttgattggtaaagatggcaagcccattaaacgt
tatgcgccgacgacgaagcctcaacagatggctggcgatattgaggctgcgttaaatgcc
tga

DBGET integrated database retrieval system