KEGG   Flagellimonas sp. HME9304: HME9304_00113Help
Entry
HME9304_00113     CDS       T05505                                 

Gene name
rocF
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
spon  Flagellimonas sp. HME9304
Pathway
spon00220  Arginine biosynthesis
spon00330  Arginine and proline metabolism
spon01100  Metabolic pathways
spon01110  Biosynthesis of secondary metabolites
spon01130  Biosynthesis of antibiotics
spon01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    HME9304_00113 (rocF)
   00330 Arginine and proline metabolism
    HME9304_00113 (rocF)
Enzymes [BR:spon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HME9304_00113 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AWX43126
UniProt: A0A2Z4LMZ8
Position
127056..127862
Genome map
AA seq 268 aa AA seqDB search
MKIYFPQWQGSGEGESIEAGAKTILDYLNDAGFVQIPLSRLSAGKNGIQKFTINNYDAIV
EQLTRLKQFISKENPTRIQTIGGDCGLEIIPVSYLNQKYPDLGIIWFDAHADINRPCDSG
SCNFHGMPLRTLLGEGEPNMNPLLFSTIQDKQIHYVGLRDIDHKEKIRLKKGDIYHPKKL
DVQDLVRTLQSKNIKNLYLHFDFDCLEPSDYDKTYYQVPDGVKIKDAENYILTLKENFNV
VGTSVLESIATKIEELKPIDAILKFLMA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttattttccgcaatggcaaggctcaggcgaaggagaaagtattgaagctggt
gccaaaactatattggattacctgaacgacgcgggttttgtccaaataccactttccaga
ttgagtgcaggtaaaaatgggatacagaaattcaccatcaacaattatgatgctattgta
gagcaattgaccagactcaaacaatttatttccaaggaaaatccaactagaattcagacc
attggaggcgattgcggtctggaaataattcctgtatcctatctcaatcaaaaatatccg
gatttagggattatttggtttgatgcacatgccgatatcaataggccgtgtgattctggc
agttgtaattttcatggcatgcccctgcgaacgcttttgggcgaaggtgaacccaacatg
aatcctttacttttcagtaccattcaagataagcaaatccattatgtcggtttaagggat
attgatcacaaagaaaaaattcgattgaaaaagggtgacatctaccacccaaaaaaattg
gatgttcaggatttagtacggacactgcaatccaaaaatatcaaaaacctatacctccat
tttgattttgattgtctggaaccttcagattacgataaaacttattaccaagtccctgat
ggggtgaaaataaaagatgctgagaattatattttaacattgaaagaaaattttaatgtt
gttggtaccagtgttttggaatccattgccactaaaatagaagaactcaagccaattgac
gctattctaaaatttttgatggcttaa

DBGET integrated database retrieval system