KEGG   Flagellimonas sp. HME9304: HME9304_00524Help
Entry
HME9304_00524     CDS       T05505                                 

Gene name
srfJ
Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
spon  Flagellimonas sp. HME9304
Pathway
spon00511  Other glycan degradation
spon00600  Sphingolipid metabolism
spon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    HME9304_00524 (srfJ)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HME9304_00524 (srfJ)
Enzymes [BR:spon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     HME9304_00524 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C LPAM_1
Motif
Other DBs
NCBI-ProteinID: AWX43535
UniProt: A0A2Z4LNU7
Position
577582..579087
Genome map
AA seq 501 aa AA seqDB search
MKKFNKFNFIITLALALSACSVDNKLKVEVYETSAQGNKLTKITDFPPQKVKAQIKLLPD
QNFQTITGFGGSFTEASAYLLNQLGQENRKKIIAAYFGDEGSRYSLTRTHMNSCDFSLSN
YSYAPVEGDLELKHFSIDEDRDDIIPFIKEAMAVSKDGFKILASPWTAPPWMKNNKDWRG
GKLLPEYYDTWALFFSKYIDAYKLEDIDIWGFTVENEPLGNNNNWESMHFTPEEMTNFVK
FHLGPKLETDGHEAKILGYDQNRGEELEEWVKVMFKNEASSKYFDGTAIHWYASTYDWFP
ESLQFAHNAAPSKYLIQSEACVDAEIPKWKDDKWYWSKEATDWGWDWAPEHEKHLHPKYA
PVYRYARDIIGCLNNWVDGWIDWNMILDTQGGPNWFKNWCVAPVIVDPDKDEVYFTPIYY
TLTHFSKYIRPGATRIGFENSDDSLMVTAVKNPDDTIVIVILNQDLKPKSFKVFLDDDFK
EISISPQAIQTIIIDKTTDAN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttaacaaatttaatttcataattacattggccctagcactgagcgcttgc
agcgtagataataaattgaaggtagaagtatatgaaacttcggcccaaggaaataaattg
accaagataacggactttccgcctcaaaaagtaaaagcgcagataaaactgctgcccgat
caaaactttcagaccataactggatttggcggttcttttacggaagcctctgcttacctg
ctcaaccaattgggtcaagaaaaccgaaaaaaaatcatcgccgcctattttggcgatgaa
ggttcgcggtattcgttgacaagaacacatatgaactcttgtgatttttccttatccaac
tattcttatgcgcctgttgaaggggatttggaattaaagcacttttccatagatgaggat
agagatgatattataccctttatcaaagaagcaatggctgtctccaaagatggattcaag
attctggcatccccatggacagcaccaccttggatgaaaaacaacaaagattggagaggc
ggaaagcttcttcccgaatattatgatacttgggcactgttcttctctaaatatatagat
gcctataaattggaggatatagatatttggggctttaccgttgaaaatgagccattgggg
aacaacaataactgggaaagtatgcatttcactccagaagaaatgaccaattttgtgaag
tttcacttaggtccaaaattagaaactgatggacatgaagcaaaaattctgggttatgat
caaaatcgtggagaagaattggaagaatgggtaaaagtgatgttcaagaatgaggcttca
tcaaaatattttgatggaacagccattcactggtatgccagcacctatgattggtttcca
gaatcgctgcaatttgcacataacgctgctccctcaaaatatttgatacaatccgaggct
tgtgttgatgccgaaatccccaaatggaaagatgacaagtggtattggtccaaagaagct
acggattggggctgggactgggcgcccgagcatgaaaaacacctacatccaaaatacgcg
cccgtatatcgttatgcccgtgatattattggatgtctaaacaattgggtagacggttgg
atagattggaacatgatcttggatacacaaggcggtccaaactggtttaaaaattggtgt
gtggcaccagtaattgttgatccagataaagatgaagtatattttactcccatttattat
acccttacccatttcagcaagtatattagaccaggtgcaactcgtattggatttgagaac
tcagacgattccttgatggtaactgctgttaaaaatccagatgatacgattgttattgta
atcttgaaccaagacttgaaacccaagagttttaaagtctttttagatgatgatttcaaa
gaaatttccattagtccacaagctattcaaactatcattattgataaaaccaccgatgct
aactaa

DBGET integrated database retrieval system