KEGG   Flagellimonas sp. HME9304: HME9304_02355Help
Entry
HME9304_02355     CDS       T05505                                 

Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
spon  Flagellimonas sp. HME9304
Brite
KEGG Orthology (KO) [BR:spon00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HME9304_02355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AWX45342
UniProt: A0A2Z4LUB6
Position
complement(2616589..2616975)
Genome map
AA seq 128 aa AA seqDB search
MFTQVTKGIRVSVQTTFEGTFFKNYKMHYAFGYTITIENQTKNTVQLTARHWDIFDALKE
IETVDGEGVIGKKPVIKPNKSHTYSSGCLLASPIGAMKGHYNMVNLASSEEFEVNIPTFK
FAAPFAIN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgttcactcaagtaaccaaaggaattagagtatcagtgcaaaccacttttgagggcact
ttttttaaaaactacaaaatgcactacgcgtttgggtatacaattacaatagagaaccag
acaaaaaataccgtacaattgaccgcaagacactgggatatttttgatgccctaaaagaa
atagaaacagttgacggcgaaggggttattggcaaaaagcctgttataaaaccaaataaa
tcgcacacctatagttctggctgcttgttggcctctcccattggtgcgatgaaaggtcac
tataatatggtaaatctagcttcatcagaagagtttgaggttaatatacccacttttaaa
tttgctgctccctttgccataaactaa

DBGET integrated database retrieval system