KEGG   Sporosarcina sp. P37: SporoP37_02545Help
Entry
SporoP37_02545    CDS       T04826                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
spop  Sporosarcina sp. P37
Pathway
spop00020  Citrate cycle (TCA cycle)
spop00190  Oxidative phosphorylation
spop00650  Butanoate metabolism
spop01100  Metabolic pathways
spop01110  Biosynthesis of secondary metabolites
spop01120  Microbial metabolism in diverse environments
spop01130  Biosynthesis of antibiotics
spop01200  Carbon metabolism
Module
spop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SporoP37_02545
   00650 Butanoate metabolism
    SporoP37_02545
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SporoP37_02545
Enzymes [BR:spop01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SporoP37_02545
    1.3.5.4  fumarate reductase (quinol)
     SporoP37_02545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_16 Fer4_2 Fer4 Fer4_13 Fer4_4 Fer4_15 Fer4_21 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ARK23679
Position
complement(456733..457518)
Genome map
AA seq 261 aa AA seqDB search
MSEQQTATAQKTVVFDIERQDTATSKPYTERFEIPYRPNMNVISALMEIRRNPVNAKGEK
TTPVNWDMNCLEEVCGACSMVINGRPRQSCTALVDQLTQPIKLQPMRTFPVVRDLVVDRE
FMFDSLKRIKAWVPIDGTYDLGEGPRMPERKRQWAYELSKCMTCGVCLEACPNVNDKTNF
MGPALMSQVRLFNAHPTGSMNKDERLATVMGDGGITECGNAQNCVVACPKGIPLTTSLGA
VGRATTIQMFKNFFGSDHQVD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacaacaaacagcaactgcacaaaaaactgtcgtgtttgatatcgagcgtcag
gacactgccacttcaaagccatacacggaaagatttgaaattccttaccgtccgaatatg
aacgttatttcggctttaatggaaatcagacgtaaccctgtaaatgctaaaggtgaaaaa
actacacctgtaaactgggatatgaactgtttggaagaagtatgcggtgcatgttcaatg
gttattaacggccgcccgcgccagtcatgtactgcgctggttgatcagttgacacagcct
attaaattgcagcctatgcgcacattcccggtcgtccgtgacttagtggttgaccgtgag
ttcatgtttgattcattgaaacgcatcaaagcatgggttccgatcgatggcacgtatgat
cttggtgaaggtccgcgtatgcctgagcgtaagcgtcagtgggcatatgaattgtctaaa
tgtatgacttgcggtgtatgtctggaagcttgtccgaacgttaacgacaagacgaacttc
atgggacctgcattgatgtcacaagtacgtttattcaacgcacacccaaccggttcaatg
aataaagacgagcgtctggcaactgtaatgggagatggcggcatcacagagtgcggtaac
gcacaaaactgtgtagttgcttgtcctaaaggtattccattgacgacttctttaggtgca
gtcggcagagcaacaacgattcaaatgttcaagaacttcttcggaagtgaccaccaggta
gattaa

DBGET integrated database retrieval system