KEGG   Sporosarcina sp. P37: SporoP37_02555Help
Entry
SporoP37_02555    CDS       T04826                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
spop  Sporosarcina sp. P37
Pathway
spop00020  Citrate cycle (TCA cycle)
spop00190  Oxidative phosphorylation
spop00650  Butanoate metabolism
spop01100  Metabolic pathways
spop01110  Biosynthesis of secondary metabolites
spop01120  Microbial metabolism in diverse environments
spop01130  Biosynthesis of antibiotics
spop01200  Carbon metabolism
Module
spop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SporoP37_02555
   00650 Butanoate metabolism
    SporoP37_02555
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SporoP37_02555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF1691
Motif
Other DBs
NCBI-ProteinID: ARK23681
Position
complement(459332..459940)
Genome map
AA seq 202 aa AA seqDB search
MSKETDFFLRRLHSLLGVIPVGLFVAQHLVINHFATRGEEAFNTASNFMGNLPFVLFLEW
FIIYIPLMFHAFYGVYIAFSAKYNVSNYGTFRNWMFTLQRFTGVFLVIFIAWHVYETRIQ
KALGAEVDFNMMADILSNPFMLVFYIAGVLSATFHLANGLWSFCVTWGISQSPESQKIVS
YITMIVFLVLSVIGVQALLAFV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgaaagaaacagattttttcttgcgccgtctacattcgttgcttggtgtaattccc
gttggactctttgttgcccaacacttagttattaaccattttgcaacgcgcggtgaggaa
gcattcaacacagcatctaattttatggggaacttgccgtttgtgctattcttggaatgg
tttattatctacattccacttatgttccacgctttttacggagtgtacatagctttctca
gcaaaatacaacgtgagcaattacggtactttccgcaactggatgttcacgctccagcgt
ttcacgggcgtattcctagtcatcttcattgcatggcacgtgtatgagactcgtatccaa
aaagcgctaggtgctgaagtagacttcaacatgatggccgatatattatcgaatccattt
atgcttgttttctatatcgcaggagtactgtctgctactttccacttagctaatggactt
tggtcattctgtgttacttggggtatttcacaatcaccagaatctcagaagattgtatct
tacattacaatgattgtattcttagttctatctgtaatcggagttcaagcacttctagca
tttgtataa

DBGET integrated database retrieval system