KEGG   Sporosarcina sp. P37: SporoP37_09910Help
Entry
SporoP37_09910    CDS       T04826                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spop  Sporosarcina sp. P37
Pathway
spop00450  Selenocompound metabolism
spop00970  Aminoacyl-tRNA biosynthesis
spop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SporoP37_09910
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SporoP37_09910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spop01007]
    SporoP37_09910
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spop03016]
    SporoP37_09910
Enzymes [BR:spop01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SporoP37_09910
Amino acid related enzymes [BR:spop01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SporoP37_09910
Transfer RNA biogenesis [BR:spop03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SporoP37_09910
 Prokaryotic type
   Other AARSs
    SporoP37_09910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 DNA_ligase_ZBD Zn-ribbon_8 Prok-RING_1 zf-Mss51
Motif
Other DBs
NCBI-ProteinID: ARK26263
Position
1914541..1916535
Genome map
AA seq 664 aa AA seqDB search
MKVYINYLEELCVENQSKTFYITTPIYYPSGKFHIGTAYTTIASDAMARYKRLRGYDVRF
LTGMDEHGQKIQEKAEEEGMTPLKYVDGIADIAKDLWKLMDISYDDLIRTTEDRHKVVVE
KIFQKFLDNGDIYKGKYDGWKCVPCESYFTESQLTDGNCPDCGRPVHRVEEESYFFNMKK
YADRLLAYYEENPTFIEPESRKNEMINNFIKPGLEDLSVSRMSFDWGIKVPGDPKHVIYV
WVDALTNYITALGYMSDDDSLFKKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKV
FAHGFIMMKDGKMSKSKGNVVYPEMLVERYGLDATRYFLLRELPFGQDGVFSPEAFVERI
NYDLANDLGNLLNRTISMINKYFDGEILTEDLVPTEFDAPLRDMIRQTAAKYEHSMEKMQ
FSVVLSDVWALISRTNKYIDETAPWVLAKSEEDRMKLASVMYHLALSLHHTAVLLQPFMT
NAPKQMIEQLGLSADSLNWDALQEEYSIPAGTTVIKKGVPIFPRLDTEVEVEYIRKQMAI
TAPAEVEEVKEEVIEEQNEITFDEFMNVDMRVATVTACEKMPKADKLLKLQVDLGYEQRQ
VVSGIAEHYKAEDVVGMKVIVVANLKPVKLRGELSQGMILAGEEDGVLKLATVDPLLENG
ARVK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatacattaactatttggaggaattatgcgtggagaatcaatctaaaacattt
tatattacaacgcctatttattacccaagcgggaagtttcatataggaacggcatatacg
accatcgcatcggatgcaatggcacgctataagcggctgcgcggctatgacgtcagattt
ttaacaggaatggacgagcatggccaaaaaatccaggagaaagcggaagaggaaggtatg
actccgctaaaatacgtagatggcattgccgatatcgcgaaggatctgtggaagctgatg
gatatttcttacgatgatttaatccgcacgacagaagaccgccataaagtcgttgtcgaa
aagatctttcagaagtttcttgataacggggacatttacaaagggaagtatgacgggtgg
aaatgtgtgccgtgtgaatcgtattttacagaatcacaattgacagatggaaattgtccg
gattgcggacgcccggttcaccgcgtagaagaagagtcttatttctttaatatgaagaag
tatgcggatcgccttcttgcgtattatgaagagaacccgacattcattgagccggaatct
cgtaagaacgaaatgattaataacttcattaaaccgggacttgaagatctttcggtgtcc
cgtatgtcatttgactggggaattaaagtgccgggggacccgaagcatgtcatttatgtg
tgggtcgatgcattgacgaactatattacagctcttggctatatgtccgatgatgactca
ttgttcaagaaatattggccggcagatgttcatgttgtagggaaagacatcgttcgcttc
catacaatctattggccaatcttcctgatggcgcttgatctgccattaccgaaaaaagta
tttgcacatggatttatcatgatgaaagacggcaaaatgtcgaaatccaaaggcaatgtt
gtctatcctgaaatgctggttgaacgctacggcctggatgctacacgttacttcttgctg
cgtgagctgccatttggacaagacggagtattttctccggaggcatttgttgagcgcatc
aactacgacttggcgaatgacttaggaaacttattgaaccgtacgatttccatgatcaat
aaatacttcgatggggaaattttgacggaagaccttgtaccaactgaatttgacgcgccg
ttgcgtgacatgattcgtcaaacggcggcgaaatacgagcattccatggaaaagatgcaa
ttcagtgtcgtgctctcagacgtatgggcattaatttcccgtacgaataaatatattgat
gaaactgcaccgtgggtattggcgaagtcagaagaagaccgtatgaaactggcatctgtc
atgtatcatttggcactttcccttcatcacacagcagttcttctgcagccgttcatgaca
aatgcgccaaaacaaatgatagaacaacttggtctttccgcagattcattaaactgggat
gctttgcaggaagagtattcaattccagccggcacgacagttatcaaaaaaggtgttcct
attttcccgcgtttggatacagaagtggaagtagagtatatccgaaagcaaatggcaatt
acggcacccgctgaagtggaagaggtaaaagaggaagtaatagaagaacagaatgaaatt
acgtttgacgagttcatgaacgtggacatgcgtgtagcaaccgtaacggcgtgtgaaaag
atgccaaaagccgacaaactgctcaaattgcaagtcgacctcggctatgaacagcgtcaa
gttgtgtccggcattgccgaacactataaagctgaagacgtagtcggtatgaaagttatt
gtcgttgcgaacttgaaaccggtcaaacttcggggagaactatcacagggcatgatcctc
gcaggcgaggaagacggtgtcctgaaacttgcaacggtcgatccgttactggaaaacggt
gcgagagtaaaataa

DBGET integrated database retrieval system