KEGG   Sporosarcina sp. P37: SporoP37_11095Help
Entry
SporoP37_11095    CDS       T04826                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
spop  Sporosarcina sp. P37
Brite
KEGG Orthology (KO) [BR:spop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SporoP37_11095
Enzymes [BR:spop01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     SporoP37_11095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ARK25145
Position
2152067..2152873
Genome map
AA seq 268 aa AA seqDB search
MKTAVIQLNTRDNKKENLEKAKKFIEQAANEGAELVSLPEYFNFMGPEEQKPGAAEVIPE
GETTTMLTELAKKHSIFIHAGSILEKHTDEKSYNTSLFIGKDGELLETYRKVHLFDIGIE
GRGTYKESDTVQAGESTKMVDLPIGKAGLSICYDLRFPELFRSYAFNGASVLFIPAAFTL
YTGMLHWEVLLRARAIENQCYVVAAGQFGTNVPGKACYGSSMIIDPWGTVVARAPEGEGF
VMADMDAETVKNARESIPCLDHRRPAVY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcagttattcaattgaatacacgagacaataagaaagaaaacttagagaaa
gcaaagaagtttattgaacaggcggctaatgaaggcgcagaactagtttcccttccggag
tacttcaacttcatggggcctgaagaacagaagccgggagcggcagaagtaattccagaa
ggcgaaactactacgatgctgacggaactggcaaagaaacacagtatcttcattcacgct
ggaagtattctggagaagcatactgatgaaaagtcatataatacgagcctgtttatcggg
aaagacggcgagttgcttgaaacgtatagaaaagtgcatctctttgatattggtatcgaa
ggaagaggaacatataaagaatcagatacagtgcaagcgggagagtctactaaaatggtt
gatctgccgattggaaaagcgggattgagtatttgttacgacttgcgattccctgaactt
ttcagaagttatgcctttaacggtgcgagtgttctgtttattccggcagctttcacttta
tatacgggaatgttacactgggaagtattactaagagcacgagcaatagaaaaccaatgt
tatgttgtggcagccggacagtttggaactaatgtgcctggaaaagcctgctatggaagc
agtatgattattgatccttggggaacagttgtcgcacgggctcctgaaggagaagggttc
gttatggcagatatggatgctgaaactgttaagaatgctagagaaagtattccttgcctc
gaccacagacgaccggcggtttactaa

DBGET integrated database retrieval system