KEGG   Sporosarcina sp. P37: SporoP37_11305Help
Entry
SporoP37_11305    CDS       T04826                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
spop  Sporosarcina sp. P37
Pathway
spop00020  Citrate cycle (TCA cycle)
spop00620  Pyruvate metabolism
spop00650  Butanoate metabolism
spop01100  Metabolic pathways
spop01110  Biosynthesis of secondary metabolites
spop01120  Microbial metabolism in diverse environments
spop01130  Biosynthesis of antibiotics
spop01200  Carbon metabolism
Module
spop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SporoP37_11305
   00620 Pyruvate metabolism
    SporoP37_11305
   00650 Butanoate metabolism
    SporoP37_11305
Enzymes [BR:spop01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     SporoP37_11305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF COG2
Motif
Other DBs
NCBI-ProteinID: ARK25183
Position
complement(2195524..2197044)
Genome map
AA seq 506 aa AA seqDB search
MANELNKVLRCEALKDKIVTAEEAASWIEDGMSLGLSGFTLSGDAKAVPLALAERGKKED
FKVNVFTGASMGPNVDQLMAEADVINLRVPYQGNPTMRGKINNGESFYIDQHLSHTAEWI
RQGVIGPVDYAIIEAAAITEDGQIIPTGSVGNSPIFVQEAKNVIIELNVNAPVEFEGLHD
IYIPEYQGDRKEIPVFSVTDKIGTPGIKVDPEKVRGIVLTEQGDIPSPIVPPDEETQEIA
NNLLTFFRDEIKLGRMDESLLPLQSGVGSVANAVLDGMRTSEFRDIEVYSEVLQDAIFDL
IDDGVVKFASATSLTLSKKRLDSFQDDIAKYRDKLVFRPQEVSNHPEVIRRLGVISFNTA
LELDIYGNVNSTHVAGTRMMNGIGGSGDFARNARIAIFVTKSYAKGGDVSSIVPFSSHVD
HTEHDVDVIVTEQGYADLRGLAPRQKAELLIENCAHPDFKEELRDYYNRACEQVGGQTPH
ILEEALSWHVNLAKNKTMHKAAEAQK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaacgaactaaataaagtacttcgttgtgaagcactaaaagacaaaattgtaaca
gcagaagaagcagcttcttggatcgaggatggaatgtcattgggtctgagcggctttact
ttgtccggggacgcgaaagcggttccattggcattggctgaaagaggtaaaaaagaagac
ttcaaagtaaacgttttcaccggtgcttccatggggccaaacgttgaccagctgatggct
gaagcagacgtaattaatttacgcgttccttatcagggtaacccgacaatgcgcggtaaa
atcaacaatggtgagtcattctatatcgatcagcatctttctcatacagctgaatggatt
cgtcaaggcgtaatcggccctgttgactatgcaattatcgaagcagctgcaattacagaa
gatggtcagattattccgactggttctgttggtaactcccctatttttgttcaggaagcg
aagaatgttatcatcgaattgaatgtgaatgctcctgttgaatttgaaggtttgcatgat
atctatattcctgaataccagggcgaccgcaaagaaattcctgttttcagcgtgacagat
aaaatcggtacacctggaatcaaagtggatcctgaaaaggtacgcggtatcgttcttaca
gagcagggagatattccgtcccctatcgttcctccagatgaagagacacaggagattgca
aacaacttgctgacattcttccgtgacgaaatcaaattgggtcgcatggacgagtcactt
cttcctcttcaatcaggtgttggttcagtagcaaacgctgttcttgacggcatgagaaca
tctgaattcagagacatcgaagtatattctgaagttcttcaggatgcaatcttcgacttg
atcgatgacggcgttgtgaaattcgcttctgcgacttcattaacactttctaaaaagcgt
ttggacagcttccaggacgatatcgctaaataccgcgataagctagttttccgtccacaa
gaagtttcaaaccacccggaagtaattcgtcgtttgggtgttatttccttcaacacggcg
cttgaactggacatctacggaaacgttaactctacacatgttgctggaacacgcatgatg
aatggtattggcggatctggtgacttcgctcgtaacgcgcgcatcgcgattttcgttacg
aagtcttacgcaaaaggcggagacgtgtcatcaatcgtacctttctcttctcacgtggac
cacacggagcacgacgtagacgtaattgtaacggaacaaggttatgcggatcttcgcggc
ctggctccaagacaaaaagcagaactgttgattgaaaactgtgctcaccctgatttcaag
gaagagctgcgcgattactacaacagagcatgtgaacaagttggcggacagactccacac
attctggaagaagccctatcttggcacgtaaatcttgcaaaaaacaagacaatgcacaaa
gctgctgaagcacaaaaataa

DBGET integrated database retrieval system