KEGG   Sporosarcina sp. P37: SporoP37_11755Help
Entry
SporoP37_11755    CDS       T04826                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spop  Sporosarcina sp. P37
Pathway
spop00071  Fatty acid degradation
spop00072  Synthesis and degradation of ketone bodies
spop00280  Valine, leucine and isoleucine degradation
spop00310  Lysine degradation
spop00362  Benzoate degradation
spop00380  Tryptophan metabolism
spop00620  Pyruvate metabolism
spop00630  Glyoxylate and dicarboxylate metabolism
spop00640  Propanoate metabolism
spop00650  Butanoate metabolism
spop00900  Terpenoid backbone biosynthesis
spop01100  Metabolic pathways
spop01110  Biosynthesis of secondary metabolites
spop01120  Microbial metabolism in diverse environments
spop01130  Biosynthesis of antibiotics
spop01200  Carbon metabolism
spop01212  Fatty acid metabolism
spop02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SporoP37_11755
   00630 Glyoxylate and dicarboxylate metabolism
    SporoP37_11755
   00640 Propanoate metabolism
    SporoP37_11755
   00650 Butanoate metabolism
    SporoP37_11755
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SporoP37_11755
   00072 Synthesis and degradation of ketone bodies
    SporoP37_11755
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SporoP37_11755
   00310 Lysine degradation
    SporoP37_11755
   00380 Tryptophan metabolism
    SporoP37_11755
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SporoP37_11755
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SporoP37_11755
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SporoP37_11755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spop04147]
    SporoP37_11755
Enzymes [BR:spop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SporoP37_11755
Exosome [BR:spop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SporoP37_11755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DbpA
Motif
Other DBs
NCBI-ProteinID: ARK25265
Position
2288651..2289841
Genome map
AA seq 396 aa AA seqDB search
MRTVILQGARTPFGKLGGALQSLSASDLGGIAIKEALSRAGIQGDQVDEVIMGTVLQAGQ
GQIPSRQAAVKGGIPYQVKTETINKVCASGMRSITLADQLIRLGDEKVIVAGGMESMSSA
PYYANVRSGLKMGDSTLVDGMIYDGLTCSFSPGNVHMGTYGNRTANDFSLSRETQDQWAL
RSHERALNAIDNKWFEDEIVPVSIPQRKGDPAVITEDEGPRRGSSLEALAKLRPAFGKDG
SVTAGNAPGINDGACAVVLMNEDEAKKQGKEPLAVILGHAEVAIEPERFPETPGHVINAL
LEKTGKTTDDIDLYEINEAFAVVALASSQIAELDEEKVNVNGGAVALGHPIGASGARVVL
TLANELKRRGGGIGIAAICSGGGQGDAIMIEVPKSN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtaatcttacagggtgccagaacaccgtttggaaaattaggcggtgcgctg
caatcactgtctgcaagtgacctaggcgggatcgcaatcaaagaggcattatcgcgtgcg
ggcatacagggcgaccaagtggatgaagtcatcatggggactgtgctgcaggcaggacag
gggcaaattccatctcgtcaagcggctgtaaagggcggcattccgtatcaggttaaaacg
gaaacgatcaataaagtttgcgcttccggaatgcgcagcatcacgcttgctgatcagctg
atccgtctcggcgacgagaaagtcattgtggcaggcggcatggagtcaatgtccagcgcg
ccgtactacgccaatgtccgctcaggattgaaaatgggtgacagcacattggtagacggc
atgatctatgacggtttgacttgttcattctctcctggcaatgtccacatgggcacatac
ggcaacaggacagcaaatgatttctcattaagccgtgaaacacaggaccaatgggcgctt
cgcagccatgagcgcgcactgaacgcaatcgataataaatggtttgaagatgaaattgtg
cctgtcagcattccgcagcgaaaaggtgacccggcagtcatcacagaagacgaaggcccg
cgcagaggcagttcactcgaagcattggcaaaactgcgtccggcattcggtaaagacgga
agtgttacagcaggaaacgcgccaggcattaacgacggagcatgtgctgtcgtgctgatg
aatgaagacgaagcgaaaaaacaaggaaaagaaccgctggctgtcattctggggcacgca
gaagtagcgattgaaccggaacgtttccctgaaacaccggggcatgtaatcaacgcactt
cttgaaaaaacgggaaagacaacagatgatatcgatttatatgaaattaatgaagcgttc
gcggtcgttgcgcttgcaagctcgcaaatcgcagaactcgatgaagaaaaagtcaatgtc
aatggcggggcagtggcacttggccacccgatcggcgcaagcggggcgcgcgtcgttcta
actttggcgaatgaactgaaacgccgcggcggcggaatcggcattgcggcaatttgttca
ggcggcggccaaggtgatgccatcatgattgaagtaccaaaatcaaactga

DBGET integrated database retrieval system