KEGG   Sporosarcina sp. P37: SporoP37_14525Help
Entry
SporoP37_14525    CDS       T04826                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
spop  Sporosarcina sp. P37
Pathway
spop00020  Citrate cycle (TCA cycle)
spop00640  Propanoate metabolism
spop00660  C5-Branched dibasic acid metabolism
spop01100  Metabolic pathways
spop01110  Biosynthesis of secondary metabolites
spop01120  Microbial metabolism in diverse environments
spop01130  Biosynthesis of antibiotics
spop01200  Carbon metabolism
Module
spop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SporoP37_14525
   00640 Propanoate metabolism
    SporoP37_14525
   00660 C5-Branched dibasic acid metabolism
    SporoP37_14525
Enzymes [BR:spop01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SporoP37_14525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 Citrate_bind ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ARK25754
Position
2910291..2911451
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKQLLRDYGVAVSKGRVAFSPKEAVAVAKELGTTPIVVKAQIHAGGRGKAGGV
KIVKNLDDVRAVAADLIGKQLVTHQTGPEGQEIKRLLVEEGIDIDQEFYIGLVVDRATDR
VTLMGSAEGGVEIEEVAEKNPEKIFYEVIDPVVGLAPFQARRMAFNMQIPSKLINKAVGL
FLGLYKVFSEKDASIVEINPLVVTKDERVLALDAKFNFDDNATFRHKDIVELRDFDEEDP
KEIEASKHDLSYISLDGNIGCMVNGAGLAMATMDTIHYYGGEPANFLDVGGGAKKEKVAA
AFKIILSDPKVKGIFVNIFGGIMKCDVIAEGVIEAAKEVGLQVPLVVRLEGTNVERGKAL
LKESGINIVAADSMAEGAKKIVELIG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaatatcaagggaagcagctattaagagattacggagtggctgtttcg
aaaggccgtgtcgctttttcaccaaaagaagcagtggcagtggcgaaagaactcggtact
acgccgattgtggtaaaagcacaaatacacgcgggcggacgagggaaagccggcggtgtc
aaaattgtaaaaaatcttgatgacgtccgggcagtagcagctgatttgatcggcaagcag
ctcgttacgcaccaaacaggtcctgaaggtcaggaaataaaacgacttcttgttgaagaa
ggaatcgatattgaccaggaattttacattggtctggtcgtggaccgcgcaactgaccgc
gtaacgttaatggggtctgctgaaggcggagtagaaatagaagaagttgctgaaaaaaat
ccggaaaagattttttatgaagtaatagatccggtagtgggattggctcctttccaggcg
cgccgcatggcgttcaacatgcaaatcccaagtaagttaatcaataaagctgtaggtcta
ttcttaggattgtataaagtattcagtgaaaaagacgcatcgatcgtagagattaatccg
ctagtcgtaacaaaggacgagcgtgtacttgcgctggatgcaaaattcaactttgacgat
aatgccacattccgtcataaagatattgtcgaattacgcgattttgatgaagaagatccg
aaagaaatcgaagcatccaaacatgacttaagttatatttcccttgacggaaatatcggc
tgtatggttaatggtgccggtttagcgatggctacaatggatacgattcattattatggc
ggagaacccgctaacttcctggatgttgggggcggcgccaagaaagaaaaagttgcagct
gctttcaaaattattttgtcagatcctaaagtaaaagggattttcgttaatatctttggc
ggaatcatgaaatgtgacgtaattgcagaaggtgtaattgaagcagcgaaagaagtgggt
cttcaagtgcctcttgttgtgcgtcttgaaggaacgaatgtggaacgcgggaaagctttg
ctgaaagaatccggaattaatattgttgcagcggattctatggcagaaggcgcgaaaaaa
atcgttgagttgataggataa

DBGET integrated database retrieval system