KEGG   Sporosarcina sp. P33: SporoP33_01115Help
Entry
SporoP33_01115    CDS       T04790                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
spor  Sporosarcina sp. P33
Pathway
spor00260  Glycine, serine and threonine metabolism
spor01100  Metabolic pathways
spor01110  Biosynthesis of secondary metabolites
spor01120  Microbial metabolism in diverse environments
spor01130  Biosynthesis of antibiotics
spor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SporoP33_01115
Enzymes [BR:spor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SporoP33_01115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ARD46978
Position
complement(230215..231264)
Genome map
AA seq 349 aa AA seqDB search
MIRFDNDYTEGAHERILQRLIETNEEQTAGYGTDEHCEVAREYIRRECGAEDADIHFLVG
GTQTNTTIIASILRPHQGAISAVSGHIASHETGAIEAAGHKVLTLPSEDGKISAAQVKDL
YDAHFTDDSQVHMVQPGLVYISNPTEFGTTYNKAELEALRDVCRECKLPLIMDGARLGYG
LASADNNLTLADYARLCDVFYIGGTKIGAMFGEAVVIINESLKKDFRYFIKQRGGLLAKG
RLLGIQFETLFEDGLYYEVSKHAVEMASIIREAFIENGFTLRYDSPTNQQFPILPDYVVT
ELSKKYSFTHWEKFDATHSTIRICTSWATKREHVDMLINDLHHICVTSS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatacgatttgataatgattatacagaaggagcacatgaacgcattttacaacgattg
atcgagacgaacgaagaacagacggccggatatggaacagatgaacactgcgaagttgcc
cgtgaatatatccgcagagagtgcggagctgaagatgcagatatacatttcctagtaggc
gggactcaaacgaacactacgattatcgcgtcaatattgcgtccccatcaaggcgcaata
tctgcagtcagcggacatatcgcatcgcatgaaacgggagccattgaagctgcgggacat
aaagtgctgactttgccgagtgaagacggtaaaattagtgcggcgcaagtgaaagattta
tatgacgcgcattttactgatgattcccaagtgcatatggtgcagccaggtttagtttac
atttctaaccctactgaatttggtaccacgtataataaagctgaattagaagccttacgt
gacgtttgcagggaatgtaagctgccgttaatcatggacggcgccagactgggctacggg
ttagcttctgccgataataatctgacgttagcggactatgccagattatgtgatgtgttt
tatattggcggtacgaaaataggtgccatgtttggtgaggcagtcgtgatcataaacgaa
tcattaaagaaagattttcgatactttatcaaacagcgcggcggtttgctggctaaaggc
agattattagggatacaatttgaaaccctatttgaagatggtttgtattacgaagtttca
aaacacgctgtggaaatggcttcgattattcgggaggcatttattgagaatggatttaca
ttgcgttatgattctccgacaaatcaacaattcccgattttacctgattatgtcgtgaca
gaattaagtaaaaagtattccttcacccattgggaaaaatttgacgcgacccacagtacg
attagaatctgtactagctgggctacaaaaagagagcatgtagacatgctgataaatgat
ttacatcatatatgcgttacttcatcataa

DBGET integrated database retrieval system