KEGG   Sporosarcina sp. P33: SporoP33_05440Help
Entry
SporoP33_05440    CDS       T04790                                 

Definition
(GenBank) sirohydrochlorin ferrochelatase
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
spor  Sporosarcina sp. P33
Pathway
spor00860  Porphyrin and chlorophyll metabolism
spor01100  Metabolic pathways
spor01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SporoP33_05440
Enzymes [BR:spor01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SporoP33_05440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-ProteinID: ARD47722
Position
1072926..1073687
Genome map
AA seq 253 aa AA seqDB search
MRAILYICHGSRVKKGQQAALAFIEKTMETAAAPIQEACFLELAEPSIAEGIARCIERGA
TEIVAIPFLLLRAGHAIADIPAELHEVMTHYPEVPIYYGDPIGVDERMVDVLIERLYETA
DVIPDGAAILLIGRGSSDPATKEDFTAIKRSFQEKTGLQNVSVGYLAACGPFFAEELERL
LKQQPKNLYILPYLLFTGILMKSIERTLKTIETSTAIHLCPALGYHPAIHTILNERASEA
AERKRGLYVPHHA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagagccattctatatatttgccacggcagccgcgtaaagaaaggacagcaggctgct
ttggcattcattgagaaaacgatggaaacagcagctgcccctattcaggaagcatgtttt
cttgaattggctgaaccttccatcgcagaaggcatcgcccgctgcatcgaacgcggtgca
actgaaatcgttgcgatcccctttttgctgttgcgtgcgggccatgcaattgccgatatt
cccgcagagcttcacgaagtcatgacacattatccggaagtgcctatctattacggcgac
ccgattggtgtggatgaacgaatggtcgatgtactgattgagagattatatgaaacagca
gacgtaattcctgacggcgccgctatcctgttgattggaagaggcagcagtgatcctgca
acaaaagaggacttcacggctattaaaagaagctttcaagaaaaaaccggcctgcaaaat
gtcagtgtaggatacttggcagcgtgcggcccattcttcgcagaagagcttgagcgcctg
ttaaaacagcagccgaagaatctttacatcttgccatacttattgtttaccggtatttta
atgaaatcaatcgaacggacactaaagactatcgaaacatcaaccgccattcatctgtgc
cccgcattgggttatcatccggccattcatacgattttgaatgaaagggccagtgaagcg
gcagaaaggaagcgtggactgtatgttccccatcatgcttga

DBGET integrated database retrieval system