KEGG   Sporosarcina sp. P33: SporoP33_05445Help
Entry
SporoP33_05445    CDS       T04790                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
spor  Sporosarcina sp. P33
Pathway
spor00860  Porphyrin and chlorophyll metabolism
spor01100  Metabolic pathways
spor01110  Biosynthesis of secondary metabolites
spor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SporoP33_05445
Enzymes [BR:spor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SporoP33_05445
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SporoP33_05445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ARD47723
Position
1073668..1074306
Genome map
AA seq 212 aa AA seqDB search
MFPIMLENMDQSTIVLVGGGHVAYHKVLNLHRFGIHPTVVSPVFHPSFTKLAQQGMVTLK
HKKAEWEDVKDAFLTLLVTDSETVNDHLAKLLKDAGKLVVHASNPALGTAQIPAVTTRGK
LIISVSTSGASPSLAKKIRTEIAETYDERYEDYLDFLSDVRQYVKRNVADRAERRSWLKE
VIEPIYLHNAEERQTFLNDLQRIFPAEQLINS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttccccatcatgcttgagaatatggaccagtcaacaatcgtgctggtcggcggcggt
cacgtcgcgtaccataaagtgcttaatctgcaccgcttcggcattcatccaaccgtcgta
agccctgtatttcacccctcatttactaaattagcgcaacaagggatggttactttaaaa
cataaaaaagcagaatgggaagatgtaaaagatgctttcctcacgctgcttgtcacggat
agtgaaacagtaaatgatcatctggcaaaactattaaaagatgccggaaaactggtagtc
cacgcgtccaatccagcccttggaactgcccaaattcccgcggtcacgacacgcggcaaa
ctgatcatcagcgtctctacgagtggtgcaagcccttctctggctaaaaaaatccgcaca
gaaattgctgagacgtatgatgaacgctacgaggactacctggactttttgtcagatgta
cggcagtatgtaaaacggaatgtggctgatcgggctgagcgcagaagctggctgaaagaa
gtaattgaaccaatttatctccataacgccgaagagcgccaaacattcttgaatgatctc
caacgaattttccctgccgaacagctcataaattcgtaa

DBGET integrated database retrieval system